KEGG   Haemophilus influenzae 10810 (serotype b): HIB_06840Help
Entry
HIB_06840         CDS       T01720                                 

Definition
adenosine 3'-phosphate 5'-phosphosulfate 3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:hiu00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(687162..687971)
Genome map
AA seq 269 aa AA seqDB search
MLALNEHLLNQVLLIAYQAGKHLQQFYQKQVHVELKEDNTPVTEADLFVSQFLTEKLTAL
FPNVPVLSEENCHISFEERKNWKEYWLIDPLDGTQQFINRTDQFSVLITLVRKNKPVLSV
IHAPILSTTYYAMDNFGAFKKQLDQVKKLTKNTTNFDRPLRIAVGATTSQEKVRSILPKD
FPCEFVVVGSSSLKSGLVAEGAVDCYVRLGQTGEWDTAGAEVLLSETHGAIFDSHFEPLT
YNQRETLINPHFVMVGDQSFDWRSVFQFN
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgctggcgctaaacgaacatttacttaaccaagtattgctgattgcttaccaagcgggt
aagcatttgcaacagttttatcaaaaacaggttcatgttgaattgaaagaagacaacacg
ccagtgacggaagcggatctttttgtgagccaatttttaaccgaaaaattgaccgcactt
ttccctaatgtccctgttctttcggaagaaaattgccatatttcctttgaagagcgtaaa
aattggaaagaatattggttgattgatcctcttgatggcacacaacaatttattaatcgt
accgatcaattttctgtgttgataaccttagttcgtaaaaataaacccgtgttaagtgtt
attcatgcaccaattttatcgacaacttattatgcaatggataatttcggcgcatttaaa
aaacaactggatcaggtaaaaaaactcactaaaaacacgacaaattttgaccgcccttta
cgaattgcggtaggtgcaaccacttcacaagaaaaagtgcggtcgattttgccgaaggat
tttccttgtgaatttgttgtggttggttcaagtagcttaaaaagcggtttggtggctgaa
ggtgcagtagattgttatgttcgtttaggacaaacaggcgaatgggataccgctggcgca
gaagtgttgctgagtgaaactcacggtgccatttttgactctcattttgagcctttaacc
tataaccaacgcgaaacattgattaatccgcattttgttatggtgggcgatcaatcgttc
gattggcgttctgtctttcaatttaattga

DBGET integrated database retrieval system