KEGG   Haemophilus influenzae 10810 (serotype b): HIB_07730Help
Entry
HIB_07730         CDS       T01720                                 

Definition
lysophospholipase L(2)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:hiu00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(790919..791854)
Genome map
AA seq 311 aa AA seqDB search
MIREPYFHQFALAELLPFFEQFPTQYLSGKRNIKLAYRHLIQSESAVRKLMILVNGRAEN
MLKWSELAYDFYHQGYDVLLFDHRGQGYSQRIIPQKGHLDEFRFYVDDMAKIIEKVTALF
SYSTQHLLAHSMGALIATYYLANYDHHINKAVLSSPFYGILLKHPIRDELIITLMNILGQ
GERYVFGKGPYQQAHLEYNELTFCKTRMKWMNRVNRKNPAINLGGPTFRWVHLCLNAIKR
LPKVIPKIEIPILILQAEKEKIVDNNNLEKLTALFPNARCEVVFNAKHEILFEQDKLRKK
TIFKMLEFLNN
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgatcagagaaccttattttcatcaatttgctcttgcagaattattgcctttttttgag
caatttcctacccaatatctttctggtaaacgaaatataaaattagcttatcgtcatttg
attcaatctgaaagtgcggtcagaaaattgatgattttagtaaatggtcgagcagaaaat
atgctgaaatggtcagagctcgcttatgatttttatcatcaaggttacgatgtattgcta
tttgatcatcgcggtcaaggctattcacagcgtattattcctcaaaaagggcatttagat
gaatttcgtttctatgtcgatgatatggcgaaaatcatcgaaaaagtaaccgcacttttc
agctattcaacgcagcatttgcttgctcattcgatgggcgcattgattgcaacctattat
ttggcaaattatgatcatcacattaataaagcggtactttcttcgcctttttacggtatt
cttttaaaacatccaattagagatgaactgattattaccctaatgaatattttaggacaa
ggcgagcgttatgtttttggtaaagggccttatcaacaagcccacttggaatacaatgaa
ttaactttctgtaaaaccagaatgaaatggatgaatcgtgtaaatcgtaaaaatccagca
attaatcttggcgggccaacattccgttgggtacatttatgtttgaacgcaattaaacgc
ttgccgaaagttattcctaagattgaaattccaatcctaattttacaagccgaaaaagaa
aaaatagtagataacaacaatcttgaaaaattaaccgcactttttccgaatgctagatgt
gaagttgtattcaatgctaaacacgaaattctatttgaacaggacaaattaagaaagaaa
acaatctttaaaatgttagaatttttaaataattag

DBGET integrated database retrieval system