KEGG   Haemophilus influenzae 10810 (serotype b): HIB_07730Help
Entry
HIB_07730         CDS       T01720                                 

Definition
lysophospholipase L(2)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:hiu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    HIB_07730
Enzymes [BR:hiu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     HIB_07730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(790919..791854)
Genome map
AA seq 311 aa AA seqDB search
MIREPYFHQFALAELLPFFEQFPTQYLSGKRNIKLAYRHLIQSESAVRKLMILVNGRAEN
MLKWSELAYDFYHQGYDVLLFDHRGQGYSQRIIPQKGHLDEFRFYVDDMAKIIEKVTALF
SYSTQHLLAHSMGALIATYYLANYDHHINKAVLSSPFYGILLKHPIRDELIITLMNILGQ
GERYVFGKGPYQQAHLEYNELTFCKTRMKWMNRVNRKNPAINLGGPTFRWVHLCLNAIKR
LPKVIPKIEIPILILQAEKEKIVDNNNLEKLTALFPNARCEVVFNAKHEILFEQDKLRKK
TIFKMLEFLNN
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgatcagagaaccttattttcatcaatttgctcttgcagaattattgcctttttttgag
caatttcctacccaatatctttctggtaaacgaaatataaaattagcttatcgtcatttg
attcaatctgaaagtgcggtcagaaaattgatgattttagtaaatggtcgagcagaaaat
atgctgaaatggtcagagctcgcttatgatttttatcatcaaggttacgatgtattgcta
tttgatcatcgcggtcaaggctattcacagcgtattattcctcaaaaagggcatttagat
gaatttcgtttctatgtcgatgatatggcgaaaatcatcgaaaaagtaaccgcacttttc
agctattcaacgcagcatttgcttgctcattcgatgggcgcattgattgcaacctattat
ttggcaaattatgatcatcacattaataaagcggtactttcttcgcctttttacggtatt
cttttaaaacatccaattagagatgaactgattattaccctaatgaatattttaggacaa
ggcgagcgttatgtttttggtaaagggccttatcaacaagcccacttggaatacaatgaa
ttaactttctgtaaaaccagaatgaaatggatgaatcgtgtaaatcgtaaaaatccagca
attaatcttggcgggccaacattccgttgggtacatttatgtttgaacgcaattaaacgc
ttgccgaaagttattcctaagattgaaattccaatcctaattttacaagccgaaaaagaa
aaaatagtagataacaacaatcttgaaaaattaaccgcactttttccgaatgctagatgt
gaagttgtattcaatgctaaacacgaaattctatttgaacaggacaaattaagaaagaaa
acaatctttaaaatgttagaatttttaaataattag

  All links  
No link information was found.   
DBGET integrated database retrieval system