KEGG   Haemophilus influenzae 10810 (serotype b): HIB_08080Help
Entry
HIB_08080         CDS       T01720                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hiu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HIB_08080
   01230 Biosynthesis of amino acids
    HIB_08080
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HIB_08080
   00051 Fructose and mannose metabolism
    HIB_08080
   00562 Inositol phosphate metabolism
    HIB_08080
Enzymes [BR:hiu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HIB_08080
Exosome [BR:hiu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HIB_08080
  Exosomal proteins of bladder cancer cells
   HIB_08080
  Exosomal proteins of melanoma cells
   HIB_08080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
822381..823172
Genome map
AA seq 263 aa AA seqDB search
MARRPLVMGNWKLNGSKAFTKELIEGLKAELHDVTGCDVAIAPPVMYLGTAEAALSGCGC
SCGGKSVIQLGAQNVDINVKGAFTGDISSEMLKDFGAKYIIIGHSERRTYHKESDEFVAK
KFGALKEAGLVPVLCIGESEAENEAGKTEEVCARQIDAVINALGVEAFNGAVIAYEPIWA
IGTGKSATPAQAQAVHAFIRGHIAAKSQAVAEQVIIQYGGSVNDANAAELFTQPDIDGAL
VGGASLKAPAFAVIVKAAAAAKN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtcgtcctttagttatgggtaactggaaattaaacggtagcaaagcattcacg
aaagaattaatcgagggattaaaagcggaattacatgatgtaacaggttgtgatgtagca
attgcccctcccgttatgtatttaggtacggctgaagctgcactttctggttgtggttgc
agctgtggcggtaaaagtgtgattcaattaggtgcacaaaacgtagatatcaatgtgaaa
ggtgcatttactggtgatatttctagcgaaatgttaaaagattttggtgcaaaatacatc
attattggccactctgaacgccgcacttatcataaagaaagcgacgaatttgtggcgaaa
aaatttggtgcattaaaagaagctggtttagtgccagtattatgtattggtgaatctgaa
gcagaaaatgaagcaggcaaaactgaagaagtatgtgcgcgtcaaattgatgcagtcatc
aatgcattaggcgtagaagcattcaacggtgcagtgatcgcatacgaaccaatctgggcg
attggcacgggtaaatctgcgactccagcacaagcacaagccgttcatgcatttatccgt
ggtcacatcgcggcgaaatcacaagccgtggcagagcaagtaattattcaatacggcggt
tctgtaaatgatgcaaatgccgctgaattatttactcagccagacattgatggcgcatta
gtgggtggcgcatcattaaaagcccctgcatttgcagtaattgttaaagcagcagctgca
gcgaaaaactaa

DBGET integrated database retrieval system