KEGG   Haemophilus influenzae 10810 (serotype b): HIB_08200Help
Entry
HIB_08200         CDS       T01720                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hiu00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    HIB_08200
Enzymes [BR:hiu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     HIB_08200
Exosome [BR:hiu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HIB_08200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
837169..838680
Genome map
AA seq 503 aa AA seqDB search
MTDKKYIIALDQGTTSSRAVLLDHNANVVEIAQREFTQIYPRAGWVEHNPMEIWATQSST
LNEVVAKAGITSDEIAAIGITNQRETTIVWEKSTGTPVYNAIVWQCRRTADITDKLKADG
HEEYIRNTTGLVVDPYFSGTKVKWILDNVEGAREKAERGELLFGTVDTWLVWKLTQGRVH
VTDYTNASRTMLFNIHTKQWDDKMLEILNIPRSMLPEVRNSSEIYGQTNIGGKGGVRIPV
AGIAGDQQAALYGHLCVHAGQAKNTYGTGCFMLLHTGNKAITSKNGLLTTIACNAKGEPE
YALEGSVFIAGASIQWLRDELKIVHDSFDSEYFAQKVTDSNGVYVVPAFTGLGAPYWDPY
ARGAIFGLSRGANRNHIVRATLESIAYQTRDVLEAMQSDSGERLQYLRVDGGATNNNFLM
QFQADILDVNVERPVVKEVTALGAAYLAGLATGFWKDLDELRDKARVERTFSPDSDNEKR
ERRYKGWKKAVKRSLEWAKEDEE
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgacagacaaaaaatacatcattgcattagaccaaggcacaacaagctctcgcgcagta
ttattagatcataatgcgaatgtggttgaaattgcacaacgtgaatttacccaaatctac
cctcgagctggttgggtagaacataacccaatggaaatttgggcaactcaaagctcaacc
ttaaacgaagtcgttgcaaaagcgggcattacatctgatgaaatcgctgctatcggtatc
accaaccaacgtgaaaccaccattgtatgggaaaaatcaaccggtacacctgtttacaac
gcgatcgtttggcaatgccgccgtactgcagacattaccgataaattaaaagccgatggc
catgaagaatatattcgtaataccacaggcttagtggttgacccttacttctctggtaca
aaagtaaaatggattttggataacgttgaaggcgcacgagaaaaagctgaacgaggcgaa
ttattatttggtaccgttgatacttggcttgtatggaaattgactcaaggccgagtgcac
gtaaccgattataccaacgcatctcgtaccatgttatttaacatccatactaaacaatgg
gatgacaagatgcttgaaatcttgaatattcctcgttcaatgttacctgaagtacgtaat
tcttctgaaatttacggccaaaccaatatcggtggtaaaggtggtgtgcgtattcctgtt
gcagggattgctggtgaccaacaagctgctctttacggacatctttgcgtacatgcaggc
caagccaaaaacacttacggcacaggttgctttatgttactccacacgggtaacaaagct
attacatccaaaaatggactactcacaaccattgcttgtaatgcaaaaggcgaaccagaa
tatgccttagaaggttctgtatttatcgcgggtgcatcaatccaatggctccgtgatgaa
ctcaaaattgttcacgatagttttgactctgaatactttgcacaaaaagtgactgatagt
aatggcgtatatgttgttccagctttcacaggcttaggtgcaccatattgggatccatat
gcgcgcggtgcgatttttggtctttctcgcggcgcaaaccgtaatcatattgttcgagca
accttagaatctattgcttaccaaacccgtgatgtcttagaggctatgcaatcagattcg
ggtgaacgattacaatatctccgtgtagatggtggtgcgacaaacaataacttcttaatg
caattccaagctgacattttagatgtaaatgtagagcgtccagttgtgaaagaagtaaca
gcgctaggcgcagcttatcttgctggtttagcaacgggcttctggaaagatttagacgag
cttcgcgataaagcccgtgtagaacgcacctttagcccagacagcgacaatgaaaaacgt
gaacgtcgctacaaaggctggaaaaaagcagttaaacgctcattagaatgggcaaaagaa
gatgaagaataa

DBGET integrated database retrieval system