KEGG   Haemophilus influenzae 10810 (serotype b): HIB_08880Help
Entry
HIB_08880         CDS       T01720                                 

Definition
(GenBank) phosphoglyceromutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Pathway
hiu00010  Glycolysis / Gluconeogenesis
hiu00260  Glycine, serine and threonine metabolism
hiu00680  Methane metabolism
hiu01100  Metabolic pathways
hiu01110  Biosynthesis of secondary metabolites
hiu01120  Microbial metabolism in diverse environments
hiu01130  Biosynthesis of antibiotics
hiu01200  Carbon metabolism
hiu01230  Biosynthesis of amino acids
Module
hiu_M00002  Glycolysis, core module involving three-carbon compounds
hiu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hiu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HIB_08880
  Energy metabolism
   00680 Methane metabolism
    HIB_08880
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HIB_08880
Enzymes [BR:hiu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     HIB_08880
Membrane trafficking [BR:hiu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    HIB_08880
Exosome [BR:hiu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   HIB_08880
  Exosomal proteins of melanoma cells
   HIB_08880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 FMO-like
Motif
Other DBs
NCBI-ProteinID: CBW29075
UniProt: E1XB59
Position
926092..926775
Genome map
AA seq 227 aa AA seqDB search
MELVFIRHGFSEWNAKNLFTGWRDVNLTERGVEEAKAAGKKLLDKGYEFDIAFTSVLTRA
IKTCNIVLEESHQLWIPQVKNWRLNERHYGALQGLDKKATAEQYGDEQVHIWRRSYDISP
PDLDPQDPNSAHNDRRYANIPSDVVPNAENLKLTLERALPFWEDQIAPAMLSGKRVLVVA
HGNSLRALAKHIIGISDAEIMDFEIPTGQPLVLKLDDKLNYVEHYYL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggaattagtatttatccgtcacggttttagtgaatggaatgcgaaaaacttattcaca
ggctggcgtgatgtgaatttaactgaacgtggtgtggaagaagcaaaagctgcgggtaaa
aaactgttagacaaaggttatgaatttgatatcgcatttacctctgttttaactcgagca
atcaaaacttgtaacatcgtgttagaagaatcccatcaattatggattccacaagtaaaa
aactggcgtttaaatgaacgtcattatggtgctttacaaggtttagataaaaaagcgact
gcggagcaatacggtgacgaacaagttcatatttggcgtcgttcttacgacatttctcca
ccagatttagatccacaagatccaaattctgcacacaatgaccgtcgctacgcaaatatt
ccatctgatgttgtgccaaacgcagaaaatttaaaattaacattagaacgtgcattacca
ttctgggaagatcaaattgcaccagcaatgctttctggcaaacgtgttttagtggttgct
cacggaaattcacttcgtgcgttggcaaaacatattatcggtatttctgatgctgaaatt
atggattttgaaattccaacaggccaacctttagttttaaaacttgatgataaattaaat
tacgtagaacattactatctttaa

DBGET integrated database retrieval system