KEGG   Haemophilus influenzae 10810 (serotype b): HIB_09400Help
Entry
HIB_09400         CDS       T01720                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Pathway
hiu00900  Terpenoid backbone biosynthesis
hiu01100  Metabolic pathways
hiu01110  Biosynthesis of secondary metabolites
hiu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hiu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HIB_09400
Enzymes [BR:hiu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     HIB_09400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: CBW29127
UniProt: E1XBB1
Position
complement(961053..962246)
Genome map
AA seq 397 aa AA seqDB search
MQKQNIVILGSTGSIGKSTLSVIENNPQKYHAFALVGGKNVETMFEQCIKFRPHFAALDD
VNAAKILREKLIAHHTPTEVLAGQQAICELAAHPDADQIMASIVGAAGLLPTLSAVKAGK
RVLLANKESLVTCGQLFIDAVKNYGAKLLPVDSEHNAIFQSLPPEAQEKIGFCPLSELGV
SKIILTGSGGPFRYTPLEQFTNITPEQAVAHPNWSMGKKISVDSATMMNKGLEYIEARWL
FNASAEEMEVIIHPQSIIHSMVRYVDGSVIAQMGNPDMRTPIAETMAYPHRTFAGVEPLD
FFKIKELTFIEPDFNRYPNLKLAIDAFAVGQYATTAMNAANEIAVQAFLDRQISFMDIAK
INLKTIEKISPYTIQNIDDVLEIDAQAREIAKTLIRE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaacaaaacattgtcattcttggttcaacgggatcaatcggtaagagtaccctt
tctgttattgaaaataaccctcagaaatatcatgcatttgcactcgtaggcggaaaaaat
gtagaaacaatgtttgaacaatgtatcaaattccgaccgcactttgcggctcttgatgat
gtaaatgcggctaaaattttacgtgaaaaattaattgcgcatcatactccaacggaagta
ttagccggacaacaagctatttgcgaactcgctgcacacccagatgccgatcagataatg
gcatcgattgttggtgccgcaggattgttaccgactctttcagcggttaaagcgggtaaa
cgggtattactggcaaataaagaatcactggtaacctgcggacagctttttattgatgct
gtaaaaaactatggcgcgaagcttttaccagtagatagtgaacataatgctatctttcaa
tcattaccgccagaagcacaagaaaaaattggtttttgcccactttctgaattaggtgta
agtaaaattatactcactggttctggcggaccattccgttacacgccacttgaacaattc
accaacataacaccagaacaagcggttgcgcaccctaattggtctatgggtaaaaaaatc
tctgtcgattcagctacaatgatgaataagggcttggaatacattgaggctcgctggctt
ttcaacgcaagtgcggaagaaatggaagtcattattcatccacaatctattatccattct
atggtacggtatgttgatggctcagtcatagctcaaatgggaaacccagatatgcgtaca
ccaattgcagaaactatggcatatcctcaccgcacttttgctggagtagaaccactcgat
ttctttaaaatcaaagaactgacatttattgaacctgattttaatcgctatccgaattta
aaactggctattgatgccttcgctgtgggtcaatatgcgacaacagcaatgaatgcagct
aatgaaattgccgtacaagcatttttagatcgtcaaattagttttatggatattgcaaaa
attaatttgaaaacaattgagaaaatttcgccttataccattcaaaatattgatgatgta
ctcgaaattgatgcacaagcaagagagattgcgaaaacactaattagagaatag

DBGET integrated database retrieval system