KEGG   Haemophilus influenzae 10810 (serotype b): HIB_09400Help
Entry
HIB_09400         CDS       T01720                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:hiu00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(961053..962246)
Genome map
AA seq 397 aa AA seqDB search
MQKQNIVILGSTGSIGKSTLSVIENNPQKYHAFALVGGKNVETMFEQCIKFRPHFAALDD
VNAAKILREKLIAHHTPTEVLAGQQAICELAAHPDADQIMASIVGAAGLLPTLSAVKAGK
RVLLANKESLVTCGQLFIDAVKNYGAKLLPVDSEHNAIFQSLPPEAQEKIGFCPLSELGV
SKIILTGSGGPFRYTPLEQFTNITPEQAVAHPNWSMGKKISVDSATMMNKGLEYIEARWL
FNASAEEMEVIIHPQSIIHSMVRYVDGSVIAQMGNPDMRTPIAETMAYPHRTFAGVEPLD
FFKIKELTFIEPDFNRYPNLKLAIDAFAVGQYATTAMNAANEIAVQAFLDRQISFMDIAK
INLKTIEKISPYTIQNIDDVLEIDAQAREIAKTLIRE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaacaaaacattgtcattcttggttcaacgggatcaatcggtaagagtaccctt
tctgttattgaaaataaccctcagaaatatcatgcatttgcactcgtaggcggaaaaaat
gtagaaacaatgtttgaacaatgtatcaaattccgaccgcactttgcggctcttgatgat
gtaaatgcggctaaaattttacgtgaaaaattaattgcgcatcatactccaacggaagta
ttagccggacaacaagctatttgcgaactcgctgcacacccagatgccgatcagataatg
gcatcgattgttggtgccgcaggattgttaccgactctttcagcggttaaagcgggtaaa
cgggtattactggcaaataaagaatcactggtaacctgcggacagctttttattgatgct
gtaaaaaactatggcgcgaagcttttaccagtagatagtgaacataatgctatctttcaa
tcattaccgccagaagcacaagaaaaaattggtttttgcccactttctgaattaggtgta
agtaaaattatactcactggttctggcggaccattccgttacacgccacttgaacaattc
accaacataacaccagaacaagcggttgcgcaccctaattggtctatgggtaaaaaaatc
tctgtcgattcagctacaatgatgaataagggcttggaatacattgaggctcgctggctt
ttcaacgcaagtgcggaagaaatggaagtcattattcatccacaatctattatccattct
atggtacggtatgttgatggctcagtcatagctcaaatgggaaacccagatatgcgtaca
ccaattgcagaaactatggcatatcctcaccgcacttttgctggagtagaaccactcgat
ttctttaaaatcaaagaactgacatttattgaacctgattttaatcgctatccgaattta
aaactggctattgatgccttcgctgtgggtcaatatgcgacaacagcaatgaatgcagct
aatgaaattgccgtacaagcatttttagatcgtcaaattagttttatggatattgcaaaa
attaatttgaaaacaattgagaaaatttcgccttataccattcaaaatattgatgatgta
ctcgaaattgatgcacaagcaagagagattgcgaaaacactaattagagaatag

DBGET integrated database retrieval system