KEGG   Haemophilus influenzae 10810 (serotype b): HIB_09450Help
Entry
HIB_09450         CDS       T01720                                 

Definition
(GenBank) glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Pathway
hiu00040  Pentose and glucuronate interconversions
hiu00052  Galactose metabolism
hiu00500  Starch and sucrose metabolism
hiu00520  Amino sugar and nucleotide sugar metabolism
hiu01100  Metabolic pathways
hiu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hiu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HIB_09450
   00052 Galactose metabolism
    HIB_09450
   00500 Starch and sucrose metabolism
    HIB_09450
   00520 Amino sugar and nucleotide sugar metabolism
    HIB_09450
Enzymes [BR:hiu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HIB_09450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3 CoA_binding
Motif
Other DBs
NCBI-ProteinID: CBW29132
UniProt: E1XBB6
Position
complement(967388..968275)
Genome map
AA seq 295 aa AA seqDB search
MKAIIPVAGLGTRMLPATKAIPKEMLTLVDKPLIQYVVNECVAAGIKEIVLVTHSSKNAI
ENHFDTSFELETMLEKRVKRQLLEEVRSICPKNVTIMHVRQGNAKGLGHAVLCGRPLVGN
ESFAVMLPDVLLAEFSADQKKENLAAMIQRFNETGASQIMVTPVPQENVSSYGVADCGGI
ELNGGESAKINSIVEKPSIEDAPSNLAVVGRYVFSAAIWDLLEKTPIGVGDEIQLTDAID
MLIEKETVEAFHMTGETFDCGDKIGYMEAFVEYGIRHEKLGKEFKTFIKNLAKTL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaattattcctgtcgccggtcttggcacacgtatgttgcccgccacgaaggcg
attccgaaggaaatgctcactttggtggataaaccgttaattcaatacgtggtaaatgaa
tgtgtagctgctggcataaaagaaattgtgctggtaacacattcatcaaaaaatgctatc
gaaaaccattttgatacatcttttgaattagaaacgatgctggaaaaacgtgtgaagcgt
cagcttctagaagaagttcgttctatctgtccaaaaaatgtaaccattatgcacgttcgt
caaggtaatgcgaaaggtttaggtcacgccgtgttatgcggtcgtcctttagtaggaaat
gaatcttttgccgttatgttaccagatgtattattagctgaatttagtgcagatcagaaa
aaagaaaatcttgctgcaatgattcaacgctttaatgaaactggcgcaagccaaattatg
gtaaccccagttccgcaagaaaatgtgagtagctatggtgttgcagattgtggtggcatt
gagcttaatggcggcgaaagtgcaaaaattaatagtattgttgaaaaaccttctattgaa
gacgcaccatcaaatcttgctgtggttgggcgttatgttttttcagcagcaatttgggat
ttgttagaaaaaacaccaattggtgttggcgatgaaatccaattaaccgatgctattgat
atgctcattgaaaaagaaaccgttgaagcatttcatatgacaggggaaacttttgattgt
ggcgataaaattggttatatggaagctttcgtagaatatggtattcgtcacgaaaaatta
ggtaaagaattcaaaacctttatcaaaaatttggcaaaaacgctataa

DBGET integrated database retrieval system