KEGG   Haemophilus influenzae 10810 (serotype b): HIB_10330Help
Entry
HIB_10330         CDS       T01720                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:hiu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HIB_10330
  Amino acid metabolism
   00330 Arginine and proline metabolism
    HIB_10330
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    HIB_10330
Enzymes [BR:hiu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     HIB_10330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1060390..1061496
Genome map
AA seq 368 aa AA seqDB search
MNKKTIVVKFGTSTLTQGSPKLNSPHMMEIVRQIAQLHNDGFRIVIVTSGAIAAGRHYLN
HPQLPPTIASKQLLAAVGQSQLIQAWEKLFAIYDIHIGQLLLTRADIEDRERFLNARDTL
HALLDNHIIPVINENDAVATAEIKVGDNDNLSALVAILVQAEQLYLLTDQQGLFDSDPRK
NSEAKLIPVVEQITDHIRSIAGGSGTNLGTGGMMTKIIAADVATRSGIETIIAPGNRPNV
IADLAYEQNIGTKFIAHQSDRLESRKQWLFAAPSAGIITIDNGAQNAILEQNKSLLPAGI
INVKGRFSRGEVVKIRTQSGKDIALGMPRYNSDALQLIKGRKSADIENVLGYEYGAVAMH
RDDMIILS
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaaaacaatcgttgtgaaattcggtacaagcacgctaactcagggttcgcca
aaactgaattcaccgcacatgatggaaatcgttcgtcaaattgcacaactgcataatgat
ggatttcgtatagtgatcgtgacttctggtgcgattgcagcgggtcgccattatttaaat
catcctcaattaccacccactatcgcctcaaagcaactgcttgcagcggttggtcagagc
caattaattcaggcttgggaaaaattatttgctatttatgatatccatatcgggcaactt
ttattaacccgtgcagatattgaagatcgcgaacgttttttaaatgcgcgagatacttta
cacgcacttttagataaccacattattcctgtgattaatgaaaatgacgcagtggcgact
gcggaaattaaagtaggtgacaatgacaatttatcggcattagtcgctattcttgtgcaa
gcggaacagctttatttattgactgatcaacaaggtttatttgatagtgatccgcgtaaa
aattctgaagcgaaattaattccagttgtagaacaaatcaccgatcatattcgatcaatt
gcaggaggaagtggtacaaatcttggtactggtggaatgatgaccaaaatcattgctgcc
gatgttgcgactcgctctggaattgaaaccattattgctccaggtaatcgcccaaatgta
attgcagatcttgcttatgaacaaaatattggtacaaaatttattgcacaccaatctgat
cgattagaaagtcgcaaacaatggcttttcgctgcgccatcggcaggtattattaccatt
gataacggtgcgcaaaatgccattcttgaacaaaataaatctttattacccgctggtatt
attaacgtgaaagggcgtttttcgcgtggtgaagtagtcaaaatacgcactcaatcaggt
aaagacattgcgctgggtatgccacgctataacagcgatgccctgcaattaattaagggc
agaaaatcagcagacattgagaatgttttaggctatgaatatggcgcagtggcaatgcat
cgtgatgatatgattattttgtcataa

DBGET integrated database retrieval system