KEGG   Haemophilus influenzae 10810 (serotype b): HIB_10330Help
Entry
HIB_10330         CDS       T01720                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hiu01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hiu00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1060390..1061496
Genome map
AA seq 368 aa AA seqDB search
MNKKTIVVKFGTSTLTQGSPKLNSPHMMEIVRQIAQLHNDGFRIVIVTSGAIAAGRHYLN
HPQLPPTIASKQLLAAVGQSQLIQAWEKLFAIYDIHIGQLLLTRADIEDRERFLNARDTL
HALLDNHIIPVINENDAVATAEIKVGDNDNLSALVAILVQAEQLYLLTDQQGLFDSDPRK
NSEAKLIPVVEQITDHIRSIAGGSGTNLGTGGMMTKIIAADVATRSGIETIIAPGNRPNV
IADLAYEQNIGTKFIAHQSDRLESRKQWLFAAPSAGIITIDNGAQNAILEQNKSLLPAGI
INVKGRFSRGEVVKIRTQSGKDIALGMPRYNSDALQLIKGRKSADIENVLGYEYGAVAMH
RDDMIILS
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaaaacaatcgttgtgaaattcggtacaagcacgctaactcagggttcgcca
aaactgaattcaccgcacatgatggaaatcgttcgtcaaattgcacaactgcataatgat
ggatttcgtatagtgatcgtgacttctggtgcgattgcagcgggtcgccattatttaaat
catcctcaattaccacccactatcgcctcaaagcaactgcttgcagcggttggtcagagc
caattaattcaggcttgggaaaaattatttgctatttatgatatccatatcgggcaactt
ttattaacccgtgcagatattgaagatcgcgaacgttttttaaatgcgcgagatacttta
cacgcacttttagataaccacattattcctgtgattaatgaaaatgacgcagtggcgact
gcggaaattaaagtaggtgacaatgacaatttatcggcattagtcgctattcttgtgcaa
gcggaacagctttatttattgactgatcaacaaggtttatttgatagtgatccgcgtaaa
aattctgaagcgaaattaattccagttgtagaacaaatcaccgatcatattcgatcaatt
gcaggaggaagtggtacaaatcttggtactggtggaatgatgaccaaaatcattgctgcc
gatgttgcgactcgctctggaattgaaaccattattgctccaggtaatcgcccaaatgta
attgcagatcttgcttatgaacaaaatattggtacaaaatttattgcacaccaatctgat
cgattagaaagtcgcaaacaatggcttttcgctgcgccatcggcaggtattattaccatt
gataacggtgcgcaaaatgccattcttgaacaaaataaatctttattacccgctggtatt
attaacgtgaaagggcgtttttcgcgtggtgaagtagtcaaaatacgcactcaatcaggt
aaagacattgcgctgggtatgccacgctataacagcgatgccctgcaattaattaagggc
agaaaatcagcagacattgagaatgttttaggctatgaatatggcgcagtggcaatgcat
cgtgatgatatgattattttgtcataa

DBGET integrated database retrieval system