KEGG   Haemophilus influenzae 10810 (serotype b): HIB_10980Help
Entry
HIB_10980         CDS       T01720                                 

Definition
beta N-acetyl-glucosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:hiu00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:hiu00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1124001..1125044)
Genome map
AA seq 347 aa AA seqDB search
MLIDLNGKELEQEEVELLSHPLVAGLILFTRNFENREQIQELIRSVRQRVKKPLLITVDQ
EGGRVQRFRDGFTMLPSMQAFQETLSATEQVSFAKEAGWQMAAEMIALDIDLSFAPVLDL
GHECRAIGDRSFSSDVKSAVNLATAFIDGMHQAGMASTGKHFPGHGHVLADSHLETPYDD
RSKDEIFSCDLQPFQQLISQNKLDAIMPAHVIYSQCDSQPASGSKYWLKEILRKKLNFQG
TIFSDDLGMKGAGVMGNFVERSKKALNAGCDLLLLCNEREGVIQVLDNLKLTENEPHFMA
RQVRLQSLFKRRVINWNDLISDQRWKLNHRNLADIQSRWLDIQAAKK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
ttgttaattgatttaaacggaaaagagttggaacaagaggaagttgagttactttctcac
cctcttgttgcaggattaattttatttactcgaaattttgaaaacagagaacaaattcaa
gaattaattcgttctgttcgccaacgagtgaaaaagcctttattgattacggtggatcaa
gaaggtggacgagttcaacgtttccgtgatggatttacaatgttgccttcaatgcaggct
tttcaagaaacactgtcagcaactgaacaagtgagttttgctaaagaagcaggttggcaa
atggcagcagaaatgattgccttggatattgacttgagttttgctcctgtgttggatttg
gggcatgaatgtcgagcgattggtgatcgcagtttttcatctgatgtaaaaagtgcggta
aatttagccaccgcttttattgatggtatgcatcaagcaggtatggcatctacaggtaaa
cattttcctggtcatggtcatgtattagccgattctcatttagaaacgccttatgatgat
cgttcaaaagacgaaatttttagttgcgatctccaacctttccaacagttaatttcacaa
aataaactcgatgcgattatgcctgctcacgtgatttattctcaatgcgatagtcagcct
gcaagtggttcaaaatattggttgaaagaaattttacgcaagaaattaaatttccaaggt
acaattttttccgatgatctaggaatgaaaggcgcgggagtaatggggaattttgtagag
cgtagtaaaaaagcactcaatgcaggttgcgatcttttattactgtgtaatgaacgtgag
ggcgtaattcaagtattagataatctaaaacttactgaaaatgaaccgcactttatggct
cgtcaagttcgcttacaaagtttattcaaacgtagagtgattaattggaacgacttaatt
tcagatcaacgttggaaactgaatcaccgaaatctcgcagatattcaaagccgttggcta
gatattcaggcagcaaaaaaatga

DBGET integrated database retrieval system