KEGG   Haemophilus influenzae 10810 (serotype b): HIB_11210Help
Entry
HIB_11210         CDS       T01720                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hiu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HIB_11210
   01230 Biosynthesis of amino acids
    HIB_11210
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HIB_11210
   00030 Pentose phosphate pathway
    HIB_11210
   00051 Fructose and mannose metabolism
    HIB_11210
   00052 Galactose metabolism
    HIB_11210
  Energy metabolism
   00680 Methane metabolism
    HIB_11210
Enzymes [BR:hiu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     HIB_11210
Protein phosphatases and associated proteins [BR:hiu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     HIB_11210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1146253..1147218)
Genome map
AA seq 321 aa AA seqDB search
MIKKIAVLTSGGDAPGMNAAIRGVVRSALAEGLEVFGIYDGYQGLYNNKIKQLNRYSVSD
VINRGGTFLGSARFPEFKDPNIRAKCAEILRSHGIDALVVIGGDGSYMGAKLLTEEHSFP
CVGLPGTIDNDVAGTDYTIGYQTALQTAVDAIDRLRDTSSSHQRISIVEIMGRHCSDLTI
SAGIAGGCEYIVASEIEFNREELIQQIERSIIRGKRHAIIAITELLTDVHSLAKEIEARV
GHETRATVLGHIQRGGSPCAFDRILASRMGAYAVDLLLQGKGGYCVGIQNEQLVHHDIID
AINNMQRIFKADWLKVAKRLE
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaaattgcagttttaacaagtggtggcgatgcgcctggtatgaatgccgca
attcgtggcgtagtacgttctgcacttgcagaaggcttagaagtatttggtatctatgac
ggttatcaaggtttatacaataataaaatcaaacaattaaatcgctatagcgtatctgat
gtgattaatcgtggcggtacttttttaggttctgcacgttttcctgaatttaaagatcct
aatattcgggcaaaatgtgcggaaattttacgttctcacggcattgatgcacttgtggtt
atcggtggtgacggttcttatatgggggcaaaattattaaccgaagaacacagtttccct
tgtgttggcttacccggtactattgataatgatgttgcaggtactgactataccatcggt
tatcaaaccgcattacaaactgcagtggatgcaatcgaccgtttacgtgatacatcaagc
tcacaccaacgtatttctatcgttgaaattatgggtcgccattgtagtgacttaaccatt
tctgcgggcattgctggcggttgtgaatatatcgtcgcatcagaaattgaatttaatcgc
gaagaattaattcaacaaattgaacgtagcattattcgcggtaaacgccacgctattatt
gcaatcactgaacttttaaccgatgttcattctctggcaaaagaaattgaagctcgcgta
ggtcacgaaactcgcgcaaccgttttagggcatattcaacgtggtggttctccttgtgct
tttgaccgtattcttgcctcacgtatgggcgcatacgcagtagatttattgctacaaggc
aaaggcggctattgcgtaggtatccaaaatgaacaactcgttcatcacgatattattgat
gccattaataatatgcagcgtatatttaaggctgattggcttaaagtggcaaaacgtttg
gaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system