KEGG   Haemophilus influenzae 10810 (serotype b): HIB_12390Help
Entry
HIB_12390         CDS       T01720                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:hiu00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:hiu00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1277752..1279026)
Genome map
AA seq 424 aa AA seqDB search
MDKFRVYGQSRLSGSVNISGAKNAALPILFAAILATEPVKLTNVPELKDIETTLNILRQL
GVIANRDGTGAVLLDASNINHFTAPYELVKTMRASIWALAPLVARFHRGQVSLPGGCSIG
ARPVDLHISGLEKLGADIVLEEGYVKAQVSDRLVGTRIVIEKVSVGATLSIMMAATLAKG
TTVIENAAREPEIVDTADFLNKMGAKITGAGSDHITIEGVERLTGCEHSVVPDRIETGTF
LIAAAISGGRVVCQNTKADTLDAVIDKLREAGAQVDVTENSITLDMLGNRPKAVNIRTAP
HPGFPTDMQAQFTLLNMVAEGTSIITETIFENRFMHIPELIRMGGKAEIEGNTAVCHGVE
QLSGTEVIATDLRASISLVLAGCIATGETIVDRIYHIDRGYEHIEDKLRGLGAKIERFSG
SDEA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggataaatttcgtgtttatgggcaatctcgtttaagtggaagtgtgaatatttcaggc
gcaaaaaacgccgcacttccaattctttttgcggctattttagctacagaaccggttaaa
ttgacaaatgttcccgaacttaaagatattgaaacaactttaaatattttgcgtcaatta
ggcgtgattgcaaatcgtgatggaactggtgcagttttactagatgcctctaatatcaat
catttcactgcaccttatgaattggttaaaactatgcgtgcttcaatttgggcattggca
cctttagtcgctcgtttccatcgaggtcaagtctcattacctggaggttgttctatcgga
gctagacctgttgatctccacattagcggtttagaaaaattaggtgcggacatcgttctt
gaagaaggatatgtaaaagcacaagtatcagatcgtcttgttggaactcgaattgtaata
gaaaaagtaagcgtaggcgcaactttatctattatgatggcagcaacccttgcgaaaggt
acgactgttattgaaaacgccgctcgtgaacctgaaattgtagatactgcagatttcctt
aataaaatgggtgcgaaaataacaggtgcaggttctgatcacattacgattgaaggtgtt
gaacgtttaactggttgtgaacatagtgttgtgccagatcgtattgaaacgggaacattc
ttaattgctgcagccatttcgggcggtcgtgttgtttgtcaaaatactaaagcggatact
ttagatgccgtaattgataaactccgtgaagctggtgcgcaagttgatgtaactgaaaat
agcattactttagatatgcttggtaatcgccctaaagcagtgaatattcgtactgcacca
catccagggttcccaactgatatgcaggctcagtttaccttattaaatatggtggcagaa
ggtacaagcattattactgaaacaatttttgaaaatcgttttatgcatattcctgaatta
attcgcatgggcggtaaagctgaaattgaagggaatacagcggtatgtcacggggttgaa
caattgtctggcacagaggtaatagcgacagatttacgcgcttcaatcagtttagtgctt
gcaggttgtatcgcaacgggtgaaaccattgtagatcgtatttatcatatcgatcgtggt
tatgaacatatcgaagataaattacgtggtctaggtgcgaaaattgaacgtttttctgga
agtgatgaagcgtaa

DBGET integrated database retrieval system