KEGG   Haemophilus influenzae 10810 (serotype b): HIB_12710Help
Entry
HIB_12710         CDS       T01720                                 

Definition
D-xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:hiu00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hiu00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1307353..1308672
Genome map
AA seq 439 aa AA seqDB search
MTTYFDKIEKISFEGEKSTNPFAFKHYDANQVILGKTMAEHLRLAVCYWHTFCWNGNDMF
GLGSLERSWQKNPNLLAGAEQKADIAFEFLNKLGVPYYCFHDVDIAPEGNSVREYVQNFH
HIVDILERKQVETGVKLLWGTANCFTNPRYMSGAATNPNPEVFAWAATQVFNAMNATQRL
GGENYVLWGGREGYETLLNTDLKREREQIGRFMQMVVEHKHKIGFKGTLLIEPKPQEPTK
HQYDYDVATVYGFLKQFGLEKEIKVNIEANHATLAGHTFQHEIATACALDIFGSIDANRG
DPQLGWDTDQFPNSVEENTLVMYEILKHGGFTTGGFNFDAKIRRQSIDPYDLFYAHIGAI
DVLALSLKRAAKMLQEETLQKIVNERYAGWNSELGQHILQGKTSLETLAQLVQQKDLAPK
PVSGQQEYLENLVNQVIYS
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgacaacctatttcgataaaattgaaaaaatctcctttgagggagaaaaatccacaaat
ccttttgctttcaaacattatgatgctaatcaagtaattttaggtaaaactatggctgaa
catttacgcttggcggtgtgttattggcataccttttgctggaatgggaatgatatgttt
gggctaggttctttggaacgaagttggcagaaaaatccaaatttgcttgctggcgcagaa
caaaaagccgatattgcttttgagtttttgaataagttaggcgtgccttattattgtttt
catgatgttgatattgcacctgaaggtaattcagtgcgggaatatgtacaaaattttcat
catattgttgatattttagaacgcaaacaagtagaaacgggtgtaaaactcttatgggga
actgcaaattgttttactaatcctcgttatatgtctggtgcagcaaccaatcctaatcct
gaggtttttgcttgggctgcaacacaagtgtttaatgcgatgaatgccactcaacgttta
ggtggagaaaattacgtattatggggtggacgtgagggatatgaaactttattgaatacc
gatttgaaacgtgaacgtgaacaaattggtcgttttatgcaaatggtggtagaacataag
cataaaattgggtttaaaggtacattattaattgagccaaaaccgcaagaaccaactaaa
catcaatatgattatgatgtggcaacagtgtatggtttcctaaaacaatttggtttagaa
aaagaaattaaagttaatattgaagctaaccacgcgacgcttgctggccatacctttcaa
catgaaattgcaacagcttgtgcattagatatttttggctcaattgatgctaatcgtggc
gatccacaattaggctgggataccgaccaattcccaaatagtgttgaagaaaatacgtta
gttatgtatgaaattttaaaacatggtggttttactactggaggttttaattttgatgcg
aaaattcgccgacaaagtattgatccttatgatttattttacgctcatatcggtgcaatt
gatgtattggcattatccttaaaacgtgcagcaaaaatgttacaagaggaaaccttacaa
aaaattgttaatgaacgctatgcaggttggaatagtgaacttggtcagcatattttgcaa
ggcaaaacttcacttgaaacacttgcgcaacttgtccaacaaaaagatttagcgccaaaa
ccagtttcaggtcagcaagaatatttggaaaatttggtaaaccaagttatttatagctaa

DBGET integrated database retrieval system