KEGG   Haemophilus influenzae 10810 (serotype b): HIB_12900Help
Entry
HIB_12900         CDS       T01720                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate: meso-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:hiu00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    HIB_12900
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HIB_12900
Enzymes [BR:hiu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     HIB_12900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1329122..1330588
Genome map
AA seq 488 aa AA seqDB search
MKKLTALFNLPELKNDIELHNMVLDSRKVKAGDLFVAIKGHQVDGNQFIDSALHSGASAV
VSETELSSEHLTVAFIRNVPVVKYYQLARHLSSLADVFYDSPSKNLTLVGVTGTNGKTTI
SQLLAQWAELLGHRAAVMGTIGNGLLGQIVEAKNTTGSAVEIQSSLSTFKHAGADFTSIE
VSSHGLAQHRVEALHFKAAIFTNLTRDHLDYHQSMENYAAAKKRLFTELDTQIKVINADD
EIGYQWLTELPDAIAVSMNADFKVGSHQWMKAINIHYHFKGADITFESSWGNGVLHSPLI
GAFNVSNLLLVITTLLSFGYPLENLLATAKSLKGVCGRMEMIQYPNKPTVIVDYAHTPDA
LEKALIAAREHCQGELWCIFGCGGDRDRGKRPLMAQVAEQFAEKIIVTKDNPRTEPQSQI
EADIVAGFKNMEKVGIIPDRAQAIQFAIESAVENDVILIAGKGHEHYQIIGSEVVHFSDQ
EIALDFLK
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactcaccgcactttttaatttgcctgaattaaagaatgatatagaactccat
aatatggtgttagatagccgtaaggttaaagctggcgatctttttgtggcgataaaaggt
catcaggtggatggaaatcaatttattgattctgctcttcattctggtgcgagtgcggtg
gtttctgagacagaattatctagcgagcatttaactgtggcgtttatcaggaatgtgccg
gtagttaaatattatcaacttgcacgtcatctttcgtccttagctgatgttttttatgat
tcgccctctaaaaatttaacccttgttggcgttacaggaacaaatggcaaaaccactatt
tctcaattattagcgcaatgggcggaattattggggcatcgtgcggctgtgatgggaacc
attggtaatggacttttggggcaaattgtagaagctaaaaatacgacaggttcagcagta
gaaattcagtcatctctttcaactttcaaacacgcaggtgcagattttacctctattgaa
gtttcatcacacggtttggcgcagcatcgtgtagaagccttgcattttaaagcagcaatt
ttcacgaatttaacccgtgatcatctagattatcatcaatctatggaaaattatgctgca
gcgaagaaacgcttgttcactgaattagatacccaaattaaagtgattaatgctgatgat
gaaattggataccaatggctaactgaactacctgatgctattgccgtaagtatgaatgcg
gattttaaagtaggttcacaccaatggatgaaagcaataaatatccattatcattttaaa
ggtgcagatattacttttgaatctagctggggtaatggtgttttgcatagcccattaatt
ggtgcttttaatgtaagtaatttattattagtaataaccacgttgttatcgtttggttac
ccattggaaaatttactcgctacggcgaaatctttaaaaggagtatgtggaagaatggaa
atgattcaatatccaaataaaccaaccgttattgtagattatgcgcatacaccagatgcg
ttagaaaaagcgttgattgctgcgcgtgaacattgccaaggcgaattatggtgcattttt
ggttgtggcggagaccgtgatagaggcaaacgtccgttaatggcacaggttgcagagcag
tttgctgaaaagattattgtgacaaaagataatccacgaacagaaccacaaagccaaatt
gaagcagatattgtcgctggctttaaaaatatggaaaaagtggggattattcctgatcgc
gcacaggcaatccagtttgcgattgaaagtgcggtagaaaatgacgtgattttaattgct
ggaaaggggcacgagcattatcaaattattggttcggaagttgtgcatttttccgaccaa
gaaattgcacttgatttcttaaaataa

DBGET integrated database retrieval system