KEGG   Haemophilus influenzae 10810 (serotype b): HIB_13540Help
Entry
HIB_13540         CDS       T01720                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Pathway
hiu00020  Citrate cycle (TCA cycle)
hiu00640  Propanoate metabolism
hiu00660  C5-Branched dibasic acid metabolism
hiu01100  Metabolic pathways
hiu01110  Biosynthesis of secondary metabolites
hiu01120  Microbial metabolism in diverse environments
hiu01130  Biosynthesis of antibiotics
hiu01200  Carbon metabolism
Module
hiu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hiu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HIB_13540
   00640 Propanoate metabolism
    HIB_13540
   00660 C5-Branched dibasic acid metabolism
    HIB_13540
Enzymes [BR:hiu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     HIB_13540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: CBW29541
UniProt: E1X718
Position
1393443..1394612
Genome map
AA seq 389 aa AA seqDB search
MNLHEYQAKQLFEHYGLPVKNGAVCQSVDEVDLVLAQLAGGKWAAKCQVHAGGRGKAGGV
KLVHDVEEARSFAEKWLGQRLVTFQTDKLGQPVNQIYFEETCDIDKEFYLSAVVDRASQK
VMFIASPAGGMNIEEVAQNSPHLLHKVEIDPLFGGLPYQGRELAFKLGLSGTQNKQFTDI
FMGLSRLFLEKDLSLLEVNPLVLTQQGNLVCLDAKISVDDNALFRHKDLLALQDLTQNDA
REAEAEKFQLNYVALEGDIGCMVNGAGLAMGTMDIVKLYGGKPANFLDVGGGATQERVAE
AFKIILTDPSVKVILVNIFGGIVRCDLIAEGVIAAVNEVGVRVPVVVRLEGTNAEIGRQI
LVQSDVNILTAQSLQQAAELAVNAAKGEH
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacacgaataccaagcaaaacaactatttgagcattatggattacccgtaaaa
aatggggcggtctgccaatctgttgatgaagtagatttggtactggctcaacttgcaggc
ggtaagtgggcagcgaaatgccaagttcatgcgggtgggcgtggtaaagcgggtggcgtt
aaattagtgcacgatgtagaggaagcaagatcttttgcagaaaaatggctaggacaacgt
ttagtcacttttcaaacggataaattgggtcagccagtaaaccagatttattttgaagaa
acttgcgatattgataaagaattttacttaagtgcggttgttgatcgcgcctctcaaaaa
gttatgtttattgcttctcctgctggtggaatgaatattgaagaagttgcgcaaaattca
ccgcacttactccataaagtcgagattgatcctttatttggaggattgccttatcaaggc
cgtgaattggcgtttaaattagggttaagtggtacgcaaaacaaacagtttaccgatatc
tttatgggcttatctcgtttgtttttagaaaaagatttatctttactggaagtcaatcca
cttgttctcactcaacaaggcaatttggtttgtctcgacgccaaaatatctgtcgatgat
aacgctttatttcgccataaagatttattggcactgcaagatttaactcaaaatgatgct
cgtgaagcagaagctgaaaaattccagttaaactatgtggctttagagggcgatattggt
tgtatggtaaacggggctgggcttgcaatgggcaccatggatattgtgaaactctatggt
gggaagcctgcgaattttcttgatgtgggtggtggtgcaacgcaagagcgggttgctgaa
gcgttcaaaatcattttaaccgatccttccgttaaagtgattttagtgaatatttttggt
ggcattgttcgttgtgatttgattgctgaaggcgtgattgctgcagtaaatgaagtgggc
gtgagagtgcctgtggttgtgcgattagaaggaacgaatgctgaaatcggtcgccaaatt
ttagtgcaaagtgacgttaatattcttaccgcacagagtttacaacaagccgcagaatta
gccgtgaatgcagcaaaaggagaacactaa

DBGET integrated database retrieval system