KEGG   Haemophilus influenzae 10810 (serotype b): HIB_13710Help
Entry
HIB_13710         CDS       T01720                                 

Definition
protein disulfide isomerase II
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Brite
Enzymes [BR:hiu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     HIB_13710
Secretion system [BR:hiu02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   HIB_13710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1411745..1412434
Genome map
AA seq 229 aa AA seqDB search
MKKIFTALLCVAAANAMADDAAIKRKLQSFNISNIVIKSSPISGIKTAVTDQGILYVSED
GKYLFEGKLYELTNNGPVDVAGKILVDKLNSYKDEMIVYPAKNEKHVVTVFMDITCHYCH
LLHQQLKEYNDLGITVRYLAFPRAGMNNQTAKQMEAIWTAKDPVFALNEAEKGNLPKEVK
TPNIVKKHYELGIQFGVRGTPSIVTSTGELIGGYLKPADLLRALEETAQ
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatttttaccgcacttttgtgcgtggctgcggctaatgcaatggcagatgat
gcggcaattaaacgcaaattacagtcttttaatatatcaaatattgttattaaatcttcg
ccgatttcaggcattaaaacggctgttacggatcaaggtatactctatgtgagcgaagat
ggaaaatatctttttgaaggtaaactttatgaactcacaaataatggccctgttgatgtc
gcaggtaaaattttagtagataaacttaattcttataaagacgagatgatcgtttatcct
gcgaaaaatgaaaaacacgtagtaacagtatttatggatattacctgtcattattgccat
ttgttacatcagcaattaaaagaatataatgatcttggcattaccgtacgttatttagct
ttccctcgtgcaggtatgaataatcaaacggcgaaacaaatggaagcgatttggacggcg
aaagatcccgtttttgctttaaatgaagcagaaaaaggcaatttaccaaaagaagttaaa
acgccaaatatcgtgaaaaaacattatgaattaggtattcaatttggtgtacgaggaaca
ccaagtattgttacctcaactggtgagcttattggcggttatttaaaaccagctgattta
ttaagagctcttgaagaaacggcacaataa

DBGET integrated database retrieval system