KEGG   Haemophilus influenzae 10810 (serotype b): HIB_14220Help
Entry
HIB_14220         CDS       T01720                                 

Definition
hypothetical protein
Orthology
K02016  
iron complex transport system substrate-binding protein
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Pathway
ABC transporters
Module
Iron complex transport system
Brite
KEGG Orthology (KO) [BR:hiu00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    HIB_14220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1479148..1480140
Genome map
AA seq 330 aa AA seqDB search
MKKMFTIFTALFALQVSAQDLTYQAGSLPEPAKIEKVLSAGNPSDVLLLAVAPEKLAGFA
GFKMESKAGALFEGEIKKLPTLGKIAGKGSTLSAEKIVALKPDLIIDVGNVAPNYKDQAD
RTFAQTQVPYLLLDGRLSETPALLRKLGKLLGNEKQAEEQAKYAEDTLKQARDFAKQHHK
TAYLARNADGLQTGQKGSIHTEAMELVGLGNVAEGDQKGLTQVSMEQLLLWNPQMIFTQY
DEFYKALENNPQWKELSAVKNQQVFFVPHTPFGWIDSPPSLNRLLGVRWLQHMLNGKANA
DFVPEIQRFYKLFYHIDLTNEQALKLFQVK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatgttcacgattttcaccgcactttttgctttgcaagtgagtgctcaagat
ttaacttaccaagcaggcagcttgcctgaaccagccaaaattgaaaaagtattaagcgca
ggtaatccgagtgatgtgttgttacttgctgttgcaccagagaaattggcaggttttgct
ggctttaaaatggaatcaaaagcaggtgcgttgtttgaaggtgagattaaaaaattaccc
acactcggtaaaattgcgggaaaaggcagtacgctttctgcagaaaaaatcgttgcgtta
aaacctgacttgattattgatgtgggtaatgttgcgccgaattataaagatcaagctgac
cgcacttttgctcaaactcaagtgccttatttgttgttagatggcagattaagtgaaacg
cctgctttgttacgtaaattaggtaaattgcttggtaacgaaaaacaagctgaagaacaa
gctaaatatgcggaagacacgctgaaacaagctcgcgattttgctaaacaacatcataaa
acagcctatttagcgcgtaatgcggatggcttgcaaactggtcaaaaaggttcgattcat
acggaagcaatggaattggttggcttgggaaacgtcgcagagggagatcaaaaaggctta
actcaagtttcaatggaacagcttttattgtggaatcctcaaatgatttttacccaatat
gatgagttttataaagcgcttgaaaacaatccgcagtggaaagaattaagtgcggtgaaa
aatcagcaagttttctttgtgccgcatacaccatttggttggattgattcaccaccgagt
ttaaaccgtttattaggcgtgcgttggttacaacatatgttgaatggtaaggcgaatgct
gactttgtgcctgaaattcaacgtttctataaattattttatcacattgatttaaccaat
gaacaagcgcttaagttgtttcaagtaaaatga

DBGET integrated database retrieval system