KEGG   Haemophilus influenzae 10810 (serotype b): HIB_14870Help
Entry
HIB_14870         CDS       T01720                                 

Definition
exonuclease V (RecBCD complex), alpha chain
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hiu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HIB_14870
Enzymes [BR:hiu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     HIB_14870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1543368..1545290
Genome map
AA seq 640 aa AA seqDB search
MLSVLHKLKERGILSQGNYYFAKLIADKQCHTDYAEPIKNLAILLAALCSWRYTQGNTCS
QLDRYLEHNLFGLAYRTTEVDYLAEIHEKIGYLPVEDWQNALRGHMAFTQDPVNQIAPMA
FQFGALYFYRAWQDEYRIVQYIKNTLKKYRTLAFSYDEIHQKLEKYFPEKQEKTDWQKVA
VAIAIKSPFSIITGGPGTGKTTTVTRLLLVLQELFDCKLHIKLVAPTGKAASRLEESIKN
ALGFMQEKMNVSNSLFNAIPQKASTLHSLLGVNAFNDYTRYNSHNPLQLDVLVVDETSMI
DLPMMAKLINALKPETRLILLGDQAQLASVEAGAVLGELSQFVNQPYSHEQATYLQATTG
YKVEGSDCSNPIRDCLCHLTESRRFDKDSGIGKLAEFIQKGKADDGLELFEHYPQELHFN
ALNDEGDAVNQVVKSAVENYRTFLKMLDDLRKQKIDPNAKNEQGISYAEAIQAQFNSVRF
LTALRNSDLGVENLNKEIALALRAEKLLWFRNEQDWYIGKPIMITENDYNVRLYNGDIGL
CLANGKVWFGNREVLTSRIPAHEPAFMMTIHKSQGSEFKHTVMVLPTEVNPVLSRELVFT
GVTRAKKELTVFADEKIWKTAIRQAVKRQSGLGKLLEDLN
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgttatctgtattacacaaacttaaagagcggggcattctttctcaaggtaattattac
tttgctaagttgatagctgataaacaatgtcatacggattatgcggaaccaatcaaaaat
ttagctatattattagctgcactttgtagttggcgttatacgcagggaaatacttgcagc
caattagatcgctatttagaacataatttatttggcttggcttatcgtacaacggaagta
gattatttagctgaaattcatgaaaagattggttatttacccgttgaagattggcaaaat
gcgttgcgcgggcatatggcatttacgcaagatcccgtcaatcaaattgcgccaatggca
tttcaatttggcgcgttgtatttctatcgcgcttggcaagatgaatatcgcatcgtgcaa
tatataaaaaataccttaaaaaaataccgcactttagccttttcttatgatgaaattcat
caaaaattagagaaatatttccctgaaaaacaggaaaaaacagattggcaaaaagtggca
gtggcgatagcgattaaaagtccattttcgattattacaggcggcccaggaacaggaaaa
accacgacagttacgcgtttattgctcgttctacaagaattatttgattgtaaattacac
atcaaattggttgcgccgactggcaaagccgcctctcgtttggaagagtcgattaaaaat
gcgttaggttttatgcaagaaaaaatgaatgtatccaattcacttttcaatgcgattcca
caaaaagccagcaccttgcatagtttactgggcgtgaatgcctttaatgattacacgcgc
tataacagtcataatcctttgcaattagatgtgttagttgttgatgaaacatcaatgatt
gatttgccgatgatggcaaaacttatcaatgcgttaaagcccgaaactcgattaatttta
ttaggcgatcaggctcaattagcctctgttgaggcgggggcagtattgggagaattatct
caatttgttaatcaaccttatagtcatgaacaagccacgtatttacaagcgacaacaggc
tacaaagtagaaggttccgattgttcaaatccaatacgtgattgcttatgccatctaaca
gaaagtcgccgttttgataaagattcaggtattggcaagttggctgaattcattcaaaaa
ggcaaagcagacgatggccttgagttatttgaacattatccgcaagaattgcactttaat
gccttaaatgatgaaggcgatgcggtcaatcaagtggtgaaaagtgcggtggaaaattac
cgcactttcttaaaaatgttggacgatttacgtaaacaaaaaattgatcctaacgctaaa
aatgaacaaggcatttcctatgccgaagctattcaagcacaatttaattctgtgaggttt
ttaaccgcacttcgtaatagcgatttaggtgttgaaaatctcaataaagaaatcgcgtta
gcgttgcgagcggaaaaattgctttggttccgtaatgaacaagattggtatatcggcaag
ccaattatgattactgaaaacgattataacgttcgcctttataacggcgatattggcctg
tgcttggcaaatggcaaagtatggtttggcaatcgagaagtgctgacaagccgaattcca
gcgcacgaacccgcttttatgatgacgattcataaatctcaaggttcagaatttaaacat
accgtcatggtgcttccaacagaagtaaatccagtactgtcgcgagaattagttttcacg
ggcgtgactcgtgcgaaaaaagaactcacagtatttgccgatgaaaaaatatggaaaaca
gcgattcgccaggccgtcaaacgccagagcggattgggaaaattattggaagatttaaat
tag

DBGET integrated database retrieval system