KEGG   Haemophilus influenzae 10810 (serotype b): HIB_15250Help
Entry
HIB_15250         CDS       T01720                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hiu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HIB_15250
Enzymes [BR:hiu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     HIB_15250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1580986..1583076
Genome map
AA seq 696 aa AA seqDB search
MQISDSLKQKAEKCGIALSHYDIDGHLIFADEKTVSTFVELLQPPPKAKGQFDDVLAAFE
NEPIDYRLNRLDLPPSAEYRYQLIDESNAILLEKILSNLSALSLPPLPFGYYQLSIFSDT
EQYRIRLLISPKTAFQPSVLKNKKVWGVNVQLYSLRSEQNWGIGDFGDLAYLIEQSAKQG
ADYVGINPLHLPYPAVPNWASPYSSSSRRWLNFLYLDIPDLPEFKRCRSVQNWFKREDIQ
AKIAALRESDCVDYSSILALKLTALESLFDFFQRSQSAEIVTRRKIFADYLKNKGEPLLL
QGLFNVLDLQEHADHQAEENTIGWLGWRKEWQHLSTAKRKALLKTRHEKIQFFAWLQWLT
EEQLSALQNLCKQSGMELGIYGDLAVNSSRGSADVWSDPDLYCVNASIGAPPDPLGPVGQ
NWNLPPYNPTVLKARGFAPFIDMLRANMQYFGVLRIDHVMGLFRLWWIPKGKTAADGAYV
HYPFDELMAILAIESVRNECLIIGEDLGTVPDEVRWKLNEFQIFSYFVLYFAQRNGEFPR
ISDYPRNAYATIGTHDVPSLQSFWHCRDLELFNQLGILNGEVLKQKYDQRVMDKQALLNS
LHRDNYLPTHYEGDALSMAMHDYLNRMIHYYLAESNSRLIGVQLENLLSQEISFNLPSTS
NEYPNWCKKLAQPLAFIFSNEALKTFFVQINQGRNV
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatctcggattctctcaaacaaaaagcagaaaaatgcggtatcgcgctttctcac
tatgatattgatggacatcttattttcgcggatgaaaagacggtttcaacttttgttgag
cttttgcagcctccgccaaaagcgaaaggacagtttgacgatgtactggctgcatttgaa
aatgaaccgattgactatcgactcaatcgtctagatctcccaccatctgcggaatatcgt
tatcagctgattgatgaatctaatgctattctgttagaaaaaatactttcaaatttatcc
gcactttctttgcctccacttccttttggctattatcaattatctattttttccgatact
gaacagtaccgcattcgtttacttatttctcctaaaacagcttttcaaccatccgtatta
aaaaataaaaaagtgtggggcgtgaatgtgcaactttacagtttacgctcagaacaaaac
tgggggattggcgattttggcgatttggcctatttgattgaacaaagtgcaaaacaaggg
gcggattatgtgggaattaatccattacatttgccatatcctgctgtgccaaactgggct
agtccttatagttcatcttcccgtcgttggttgaatttcttatatttggacattcctgat
ttacccgaatttaagcgttgccgttcagtacaaaattggtttaagcgtgaggatattcaa
gcaaaaattgctgctttacgtgaaagtgattgcgtcgattattcttcaatattggcttta
aaattaaccgcacttgagtccctgtttgatttctttcagcgtagtcaatccgctgaaatt
gtgacacgtcgaaaaatctttgctgattatttaaaaaacaaaggtgaacctttgttgtta
cagggtttatttaatgtcttggatttgcaagaacacgccgatcatcaagcagaagaaaat
accattggttggcttggctggcgtaaggaatggcaacatttaagtacggcaaaaagaaaa
gccttattaaaaacacgccatgagaaaatccaattttttgcttggttgcaatggcttaca
gaagaacaactttccgcattacaaaatctttgtaaacagtctggtatggagttggggatt
tatggcgatttagccgtaaatagttctcgtggcagtgctgatgtatggagcgatcctgat
ttatattgtgtaaatgcctctattggtgcgccgcccgatccgttaggccctgtaggacaa
aattggaatttgccaccttataatccaaccgtgctaaaagcacgtggctttgcaccattt
atcgatatgctacgtgccaatatgcaatatttcggtgtgcttcgcatcgatcatgttatg
ggcttatttcgtttgtggtggattccaaaaggaaaaactgcggctgacggtgcttatgtg
cattatccttttgatgaattaatggctattcttgccattgaaagtgtacgcaatgaatgt
ttgattatcggtgaagatctcggcactgtgcctgatgaagtgcggtggaaattaaacgag
tttcaaattttctcttattttgtgttgtatttcgcccaacgaaatggcgaatttcctcgt
atatctgattatcctcgaaatgcttatgccactattggtacacatgatgttccctcatta
caaagtttttggcattgtcgtgatttagaattatttaatcaactcggtattctgaatggg
gaagtgctcaagcaaaaatatgatcaacgtgtcatggataaacaagccttattaaatagt
ttgcatcgtgataattatttaccgacgcattatgagggcgatgcgctttctatggcgatg
cacgattatttaaatcgaatgatccattattatttagcggaaagtaacagccgattgatt
ggtgtgcaattagaaaatttacttagccaagaaatcagttttaatttaccgagcacctca
aatgaatacccaaactggtgcaagaaacttgctcaaccgttagcgtttatttttagcaat
gaagctttaaaaacgttctttgtgcaaattaaccaagggcgaaatgtataa

DBGET integrated database retrieval system