KEGG   Haemophilus influenzae 10810 (serotype b): HIB_15260Help
Entry
HIB_15260         CDS       T01720                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:hiu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HIB_15260
Enzymes [BR:hiu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     HIB_15260
Exosome [BR:hiu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HIB_15260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1583086..1585278
Genome map
AA seq 730 aa AA seqDB search
MTTAVTQAIIDGFFDASNGDPFATLGMHETEQGIEIRTLLPDANRMVVIERESGKEITEL
DCVDERGFFVGVIPNCRQFFAYQLQVFWGNEAQIIEDPYRFHPMIDDLEQWLLAEGSMLR
PYEVLGAHFMECDGVSGVNFRLWAPNARRVSIVGDFNYWDGRRHPMRFHIKSGVWELFLP
KASLGQLYKFELIDCHGNLRLKADPYAFSSQLRPDTASQVSALPNVVEMTEARKKANQGN
QPISIYEVHLGSWRRNLENNFWLDYDQIADELIPYVKEMGFTHIEFLPLSEFPFDGSWGY
QPLGLYSPTSRFGSPEAFRRLVKRAHEAGINVILDWVPGHFPSDTHGLVAFDGTALYEHE
DPREGYHQDWNTLIYNYGRNEVKNFLSSNALYWLERFGVDGIRVDAVASMIYRDYSRVEG
EWIPNQYGGRENLEAIEFLKHTNWKIHSEMAGAISIAEESTSFAGVTHPSENGGLGFNFK
WNMGWMNDTLAYMKLDPIYRQYHHNKMTFGMVYQYSENFVLPLSHDEVVHGKYSLLGKMP
GDTWQKFANLRAYYGYMWGYPGKKLLFMGNEFAQGREWNYEESLDWFLLDENIGGGWHKG
VLKLVKDLNQIYQKNRPLFELDNSPEGFDWLVVDDAANSVFAFERRSSNGERIIVVSNFT
PVPRHDYRIGVNIVGEYEEILNTDSMYYQGSNVGNFGCVASENIESHGRENSISVSIPPL
ATVYLRLKAK
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccgcagtaacacaagcaattattgatggtttttttgatgcgagcaatggtgat
ccttttgctacgcttggtatgcacgaaaccgagcaaggaattgaaatccgtacgttattg
ccagatgccaatcgaatggtggtgattgagcgtgaaagtggtaaagaaataacggaactg
gattgtgtcgatgagcgtggattttttgttggtgttattccaaattgtcgtcaatttttt
gcttatcaattacaggttttttggggtaatgaagcacaaattatcgaagatccttatcgt
tttcatccaatgattgacgatttagaacaatggctacttgctgaaggttcgatgcttcgc
ccctatgaagtgcttggtgcgcattttatggaatgtgatggtgtgagcggggtgaatttc
cgcttgtgggcacctaatgcaagacgagtttctattgtaggcgatttcaactattgggat
ggtcgccgtcatcctatgcgttttcatataaaaagtggtgtttgggagctctttttacca
aaagccagtttaggacagctctataagtttgaattaattgattgccatggcaatcttcgt
ttgaaggccgatccttatgcctttagttcgcaacttcgccctgatacagcttcgcaagtc
agtgccttgccaaatgtagtggaaatgactgaagcacgcaaaaaagcaaaccaaggcaac
caaccaatttctatttatgaagtgcatttaggatcttggcgtcgtaatttagaaaacaat
ttttggctagattacgatcaaattgctgatgaattaattccttatgtaaaagagatgggc
ttcacccatatagaatttttaccgctttctgaatttccatttgatggttcttggggctat
caaccacttggactttattcgccaaccagtcgttttggctcacctgaggcatttcgccgt
ttagtaaaacgtgctcacgaagctggcatcaacgtgattttagattgggtgccaggacat
ttcccaagtgatacgcatggtttagttgcatttgatggcacagccttgtatgaacatgaa
gaccctcgtgaaggctatcatcaagattggaataccttgatttataactatgggcgtaat
gaggtcaagaatttcttatccagtaatgcactgtattggcttgaacgttttggcgtagat
ggtattcgcgtggatgctgtggcttccatgatttaccgtgattatagccgtgtggagggc
gagtggattccaaaccaatacggcggacgtgaaaacttagaagccattgaatttttaaaa
cacaccaactggaaaattcacagtgaaatggcgggtgcaatttctattgcggaggaatct
acctcttttgcaggcgtaacccacccaagcgaaaatggtggattgggctttaattttaaa
tggaatatgggctggatgaacgacacgcttgcttatatgaagctcgatccgatttaccgc
caatatcatcacaacaaaatgacctttggaatggtatatcaatacagcgaaaattttgtt
ctaccactttctcacgatgaagtggttcacggtaaatattcacttcttggcaagatgccg
ggcgatacatggcaaaaattcgctaacttgcgtgcatattacggttatatgtggggctac
ccaggcaaaaaattactctttatggggaatgaatttgctcaaggcagagaatggaattac
gaagaaagtttggactggttcttgcttgatgaaaatattggcggaggctggcacaaaggc
gtattgaagctggttaaagacctcaatcaaatttatcaaaaaaatcgaccgctctttgag
ctcgacaactccccagagggtttcgattggcttgtcgttgatgatgcggcaaattccgtg
ttcgcctttgaacgtcgcagttcaaacggagaacgtattattgtcgtcagtaactttacc
cctgtgcctcgccacgactaccgcatcggcgtgaatattgtgggcgaatatgaagaaatt
ttgaataccgattcaatgtactatcaaggctcaaatgtgggcaattttggttgtgtcgca
agtgaaaatatcgaaagccacggacgagaaaattcgatttcagtgtccattccgccgtta
gcaacagtttatttgagattgaaggcgaaataa

DBGET integrated database retrieval system