KEGG   Haemophilus influenzae 10810 (serotype b): HIB_15610Help
Entry
HIB_15610         CDS       T01720                                 

Definition
(GenBank) fused indole-3-glycerolphosphate synthetase/N-(5-phosphoribosyl)anthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Pathway
hiu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hiu01100  Metabolic pathways
hiu01110  Biosynthesis of secondary metabolites
hiu01130  Biosynthesis of antibiotics
hiu01230  Biosynthesis of amino acids
Module
hiu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hiu00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HIB_15610
Enzymes [BR:hiu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HIB_15610
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     HIB_15610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: CBW29748
UniProt: E1X7M5
Position
1632161..1633594
Genome map
AA seq 477 aa AA seqDB search
MMITQDFTKPIDSATVLQKIVLDKAQWVKAKEKEFPLSQFKQNIQNSDRSFYDALAKGTH
QKPAYILECKKASPSKGLIRAEFNLEEIANVYKHYASAVSVLTDEKYFQGNFEFLPLVRD
IVSQPVLCKDFMISEYQVYLARYYQAHAILLMLSVVNDETYRVLAELAHSLGMGVLTETS
NEEEFERALALGAKIIGVNNRNLHDLTVDLNRVVELTEKYADCIPADVRIISESGIYNHK
QIHQLQKVAHGFLIGSSLMGNQDLNNAVRSVIFGENKACGLTRAQDVKIVYENGALYGGL
IFAEHSKRCVSLRQAQELVTAAPLRFVGVFQNQEIDFIVKIANQLQLYAVQLHGAETEAF
ITALRQQLPKNTQIWKAISVNTETQSAVDFTDDLNVDRYIFDSQIANQQGGTGKTFDWSL
IPENLKHKIILAGGISPNNVEQAIQQNCLGLDLNSGVESSAGVKDQEKVRLVFNNIY
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgatgattactcaagattttactaaacccattgattccgctacggtgctacaaaaaatc
gtgcttgacaaagcgcaatgggttaaagcaaaagaaaaggaatttcccctttcacaattt
aaacaaaacattcaaaactctgaccgctctttttatgatgcgttagcaaaaggcacgcat
caaaagcccgcttacattttggaatgtaaaaaagcctccccttctaagggattaattcgt
gctgaatttaatttggaagaaatcgccaatgtctataaacattatgcctctgctgtatct
gtgctaactgacgaaaaatactttcaagggaattttgaattcttgcctttagttcgcgat
atcgtaagccaacctgtgctttgcaaagattttatgattagcgaatatcaagtttacctt
gctcgctactatcaagcgcatgcaattttattaatgctttctgtggtaaacgatgagact
tatcgtgtgctggcagagcttgcgcattctcttggtatgggcgtattgacagaaaccagt
aatgaagaagaatttgaacgtgcccttgcgcttggtgcgaaaatcattggtgttaataat
cgtaacttgcacgatttaactgtggatttaaatcgtgttgttgaactcactgaaaaatac
gccgactgtattcctgctgatgtacgtattattagcgaatcaggcatttacaatcacaag
caaattcatcaattacaaaaggtggcgcatggtttcttaattgggagtagtttaatgggc
aatcaagatttgaataatgcggttcgctcggtaatttttggagaaaataaagcatgcggt
ttaacgcgcgcgcaagatgtcaaaatcgtttacgaaaacggcgcactctacggcggatta
atcttcgcagaacattcaaaacgctgtgtgagtttacgccaagcgcaagaattagtaacc
gctgcgccacttcgatttgttggtgtttttcagaatcaagaaattgactttatcgtcaaa
atagccaaccaattacagctttatgcggtgcaattacatggtgcagaaactgaagcattt
attaccgcacttcgccagcaactaccaaaaaacacgcaaatctggaaagcgatttcggtc
aatactgaaacccaaagtgcggttgattttactgatgatttaaatgtggatcgttatatt
tttgatagtcaaatcgcgaaccagcaaggtggcacgggtaaaacctttgattggtcatta
attcctgaaaatcttaaacacaagattattttagctggaggcatctcaccaaataatgtg
gaacaagccattcaacaaaattgcttaggcttggatcttaattctggggtggaaagttct
gcgggcgtaaaagatcaagaaaaagtgcggttagtttttaataatatttattaa

DBGET integrated database retrieval system