KEGG   Haemophilus influenzae 10810 (serotype b): HIB_15680Help
Entry
HIB_15680         CDS       T01720                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:hiu00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:hiu00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:hiu03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:hiu03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hiu03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1639668..1640102)
Genome map
AA seq 144 aa AA seqDB search
MAKTAQFYILTENCTLTVEEIACNLAASIWRSGKKVLISCESEAQALEIDERLWQRDPNE
FVPHNLSGEATQYPTPIEISWLGKRNLQRRDVLINLQQEIPDFSHSFTQIIDFVPKDDAL
KTQARERYKQLRLQGWNLSTENVG
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaactgcacaattttatattcttacggaaaattgtactttaactgtcgaagaa
atagcctgtaatcttgctgcttcaatatggcgttcagggaaaaaagtactaattagttgc
gaaagtgaggctcaagcgctagagattgacgagcgtttgtggcaacgagatcccaatgaa
tttgttccgcataatttatcaggggaggcaacacaatatcccacaccgattgagatttca
tggcttgggaaacgaaatttacaacgccgtgatgtgttaattaatttgcaacaagaaatt
ccagattttagccacagttttacccaaattattgattttgtgccgaaagatgatgcgtta
aaaacacaagcccgagaacgttataaacaattacgtctgcaaggttggaatctttctact
gaaaatgtgggttaa

DBGET integrated database retrieval system