KEGG   Haemophilus influenzae 10810 (serotype b): HIB_16360Help
Entry
HIB_16360         CDS       T01720                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hiu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HIB_16360
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HIB_16360
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HIB_16360
Enzymes [BR:hiu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HIB_16360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1687056..1687862
Genome map
AA seq 268 aa AA seqDB search
MSRFETQFATLNAKNEGAFVPFVTLCDPTFDRSFEIICTLVDNGADALELGFPFSDPLLD
GPVIQAANNRALTAGHSSEDSFKLLEKVRSKYPEIPISLLLCANLIFAKGLDAFYQRCAE
VGVDAVLVADIPLLAKEDYVQAAKKHGIQPVFICPPNADEKTIQGVAKNSEGYTYLVSRA
GVTSAENQAHAANLDTLVEQLKAHNAPPILQGFGIAQPEQVKEALALGVAGAISGSATVK
IIERNLDNHEQCLAELAEFVQTMKAATK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagccgttttgaaacgcaatttgcgacacttaacgcaaaaaatgaaggggctttcgtg
ccgttcgttaccctttgcgaccctactttcgaccgctcttttgagatcatttgcacactt
gtggataacggtgcagatgctttagaactcggttttcctttttccgatccgctactcgat
ggcccagttattcaagccgcgaataatcgtgctttaactgcaggtcatagcagtgaagat
agctttaaactattggaaaaagtgcggtcaaaatatcccgagattccgattagcttatta
ctttgtgccaatttaatttttgctaaaggtttagatgctttttatcaacgttgtgcagaa
gtcggggttgatgctgtgcttgtggcagatattccgttactggcaaaagaagattatgta
caagcggctaaaaaacacggtattcaacccgtctttatttgcccacccaatgcggacgag
aaaacgatccaaggcgtagcgaaaaatagcgaaggctatacctatttagtttcccgtgct
ggcgtaaccagtgcagaaaatcaagcccacgcagcaaatttggatacccttgtagaacaa
cttaaagcccacaatgccccgccaattttacaaggcttcggcattgcacagcctgaacaa
gtaaaagaagctttagctttgggggtggctggtgcaatttcaggttcggcaacggtgaaa
attattgagcgaaatttagataatcacgagcaatgtttagctgaattagctgaatttgtt
caaacgatgaaagctgcaacaaaataa

DBGET integrated database retrieval system