KEGG   Haemophilus influenzae 10810 (serotype b): HIB_16720Help
Entry
HIB_16720         CDS       T01720                                 

Definition
7,8-dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hiu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HIB_16720
Enzymes [BR:hiu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     HIB_16720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1714318..1715145
Genome map
AA seq 275 aa AA seqDB search
MKLYANNKCLDLSEPQIMGILNFTPDSFSDSGQFFSLDKALFQVEKMLEEGATIIDIGGE
STRPNADEVSEQEELHRVVPVVEAVRNRFDCWISVDSSKAIVMREVANVGMDLINDIRAL
QEPNALETAVKLALPVCIMHMQGQPRTMQANPYYENVVQDVLAFLQKRTNECLFAGIKKE
NLIWDMGFGFGKSVQHNYQLLQNLNEFCKNGYPVLAGLSRKSMIGAVLDKPVDQRIIGSA
AGTLIAAQKGAKILRVHDVAATSDMLKVWQATENA
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaaactttacgcaaataataaatgtcttgatttaagcgagcctcaaattatggggatt
cttaattttacgcctgattctttttctgatagcggacagttttttagtctagataaagca
ctttttcaagtggaaaaaatgctagaagagggggcaacaattattgatattggtggagaa
tccactcgtccgaatgcggatgaagtttctgaacaagaggaattgcatcgtgttgtgcca
gtagtggaggcggtgcgaaaccgttttgattgctggatttctgttgattcctcaaaagca
attgtgatgcgtgaagtggcaaatgttggaatggatttgattaatgatattcgcgctttg
caagagccaaatgccttagaaacggcagtaaaactggctttacctgtttgtattatgcat
atgcaagggcaacctcgcacgatgcaagcaaatccttattatgaaaatgtcgtgcaagat
gtattggcttttttacaaaaacgtactaatgaatgtctttttgctggcattaaaaaagaa
aatttaatttgggatatgggctttggctttggcaaatctgtacagcataattatcaatta
ttacaaaatctgaatgaattttgtaagaatggctatccagtattagcgggattatctcgc
aaatcaatgattggtgcagtgcttgataaacctgttgatcaaagaataattggcagtgcg
gcaggcacgcttattgcagcgcaaaaaggtgcaaaaattttacgcgtacatgatgttgct
gcaacatcagatatgctcaaagtttggcaggcaacagaaaatgcctga

DBGET integrated database retrieval system