KEGG   Haemophilus influenzae 10810 (serotype b): HIB_18400Help
Entry
HIB_18400         CDS       T01720                                 

Definition
dihydrolipoyltranssuccinase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hiu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HIB_18400
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HIB_18400
  Amino acid metabolism
   00310 Lysine degradation
    HIB_18400
Enzymes [BR:hiu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     HIB_18400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1877685..1878914)
Genome map
AA seq 409 aa AA seqDB search
MTIEILVPDLPESVADATVATWHKKLGDTVKRDEVIVEIETDKVVLEVPALSDGVLAEVV
QAEGETVVSKQLLGKISTAQEGDVSSATLKATNEPTPSDRQNAAIENSHNHNVDQSPAIR
RLLAEHDLQADQIQGSGVGGRLTREDIEREIAKRQAQQVKQEAATEQNTISTVAYSARSE
KRVPMTRLRKRIAERLLEAKNSTAMLTTFNEVDMQPIMTLRKTYGEKFEKQHSVRLGFMS
FYIKAVVEALKRYPEVNASIDGDDVVYHNYFDISIAVSTPRGLVTPVLRDCDKLSMAEIE
KQIKALAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKERPI
ALNGQVVIRPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLLEI
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcgaaattcttgttccagacctacctgaatcagttgcagatgcaactgttgct
acttggcataaaaaactgggcgatactgtgaaacgtgatgaggttattgtggaaattgaa
acggataaagtcgtgctagaagttcccgcactttctgatggtgtactggctgaagttgtt
caagctgagggcgaaacagtggtgagtaaacagttgctaggcaaaatttctacggctcaa
gaaggagatgtcagttcagcgacgttaaaagcaacgaatgaacccacaccttctgatcgt
caaaatgcagcgattgaaaatagtcataatcataatgtggatcagagccctgcaattcgt
cgtttattagcagaacatgatttacaagcagatcaaattcaaggttcgggagtgggtggt
cgtttaacacgtgaagatattgaacgtgaaattgcaaaacgacaagcacagcaagtgaaa
caagaagctgccactgagcaaaatacaattagtacggtggcttatagtgcacgttctgaa
aaacgtgtgccaatgacccgtttgcgtaaacgtattgctgaacgtttacttgaagccaaa
aatagtacggcgatgcttaccactttcaatgaagtggatatgcagccgataatgactctg
cgtaaaacctacggcgaaaaatttgaaaaacaacattcagtacgtttaggatttatgtct
ttttatattaaagcggttgtggaagcattgaaacgctatcctgaagtgaatgcttctatt
gatggggatgatgttgtttaccataactattttgatattagtattgcagtttcaacaccg
cgtggattagtcacaccagtgcttcgtgattgcgataagctcagtatggcagagatcgaa
aaacaaattaaagcattagctgaaaaaggtcgtgatggcaaattaacagtagaagatctt
actggcggcaattttactattacaaatggtggcgtgttcggttctcttatgtccactcca
attatcaatccaccacaaagtgcgattttaggaatgcacgctattaaagaacgcccgatt
gcgcttaatggtcaagttgtgattcgtcctatgatgtaccttgctttatcttacgatcat
cgtttaattgacggccgtgaatctgttggtttcttggtaacgattaaagaattattggaa
gatccaacaagattgttattagaaatctaa

DBGET integrated database retrieval system