KEGG   Haemophilus influenzae 723: NTHI723_00839Help
Entry
NTHI723_00839     CDS       T03722                                 

Gene name
thlA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hix  Haemophilus influenzae 723
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:hix00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NTHI723_00839 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    NTHI723_00839 (thlA)
   00640 Propanoate metabolism
    NTHI723_00839 (thlA)
   00650 Butanoate metabolism
    NTHI723_00839 (thlA)
  Lipid metabolism
   00071 Fatty acid degradation
    NTHI723_00839 (thlA)
   00072 Synthesis and degradation of ketone bodies
    NTHI723_00839 (thlA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NTHI723_00839 (thlA)
   00310 Lysine degradation
    NTHI723_00839 (thlA)
   00380 Tryptophan metabolism
    NTHI723_00839 (thlA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NTHI723_00839 (thlA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NTHI723_00839 (thlA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    NTHI723_00839 (thlA)
Enzymes [BR:hix01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NTHI723_00839 (thlA)
Exosome [BR:hix04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NTHI723_00839 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
854461..855642
Genome map
AA seq 393 aa AA seqDB search
MENVVIVSAVRTPIGSFNGALSSVSAVDLGAIVIQEAIKRANIESALVNEVIMGNVLQAG
LGQNPARQAALKAGIEKEIPSLTINKVCGSGLKSVALGAQSIISGDADIVVVGGMENMSQ
APYLLDSKVRQGVKMGNLTLRDTMIEDGLTCASNHYHMGITAENIAEQYGISRQAQDELA
LRSQTLASQAVQLGVFDKEIIPVMVKTRKGDIIVSRDEYPKADTTAEGLAKLKPAFKKEG
TVTAGNASGINDGAAALILVSESKAHALGLKAIAKIRSYASGGVDPSVMGLGPVPATQKA
LKKAGINLDDIDLIEANEAFASQFLGVGKDLNLDMNKTNIHGGAIALGHPIGASGARILV
TLLHNLIEKDKKLGLATLCIGGGQSISMIVERL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatgttgttattgttagtgcagttagaacaccgatcggcagctttaatggtgca
ttatcttccgtaagtgcggttgatttaggcgcaattgtgatacaagaagccatcaaacgt
gccaacattgaaagtgcattagttaatgaagtcatcatggggaacgtattacaagcagga
ctagggcaaaatccagcccgtcaagcagcattaaaagcaggaatagagaaagaaatccct
tctttaacaatcaataaagtatgtggatctggtctaaaaagtgtcgcattaggtgcacag
tctattatcagtggtgatgctgatattgttgttgtgggtggcatggaaaatatgagccaa
gcaccttatcttttagatagcaaagtacgacaaggcgtcaaaatgggtaatctcacatta
agggacacaatgattgaagacggactaacttgtgctagcaatcactatcatatggggatt
actgccgaaaatattgcagaacaatatggtattagccgccaagcacaagatgaactcgca
ttacgttcacaaaccttagcatctcaagccgtgcaattaggtgtatttgataaggaaatt
atccctgttatggtaaaaactcgcaaaggtgacattattgtttcacgagacgagtatcct
aaagcagatactacagctgaaggtttagctaaattaaaacctgctttcaaaaaagagggt
actgtcaccgcaggtaacgcttctggcattaatgatggtgctgcagcacttattttagtt
agcgaaagcaaagctcatgcacttggattaaaagccattgcaaaaattagaagctatgcc
agcggtggggtagatccatctgttatgggattaggtccagttccagcaacgcaaaaagca
ttgaaaaaagcaggaataaatcttgatgatatcgatctgatagaagcaaatgaagccttt
gcctcacagttcttaggtgttggcaaagatctcaatttggatatgaataaaaccaatatt
catggtggagctatcgcacttgggcatccaatcggcgcgagtggtgcaaggattttagta
acgttattgcacaatcttatcgaaaaagataaaaaacttggacttgctacactttgtatt
ggcggtggtcaaagtatttctatgattgtagaacgcttataa

DBGET integrated database retrieval system