KEGG   Haemophilus influenzae R2866 (nontypeable): R2866_0025Help
Entry
R2866_0025        CDS       T01981                                 

Gene name
cysQ
Definition
Probable 3'-phosphoadenosine 5'-phosphosulfate (PAPS) 3'-phosphatase (CysQ) (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
hiz  Haemophilus influenzae R2866 (nontypeable)
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hiz00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    R2866_0025 (cysQ)
Enzymes [BR:hiz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     R2866_0025 (cysQ)
Transfer RNA biogenesis [BR:hiz03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    R2866_0025 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
23747..24556
Genome map
AA seq 269 aa AA seqDB search
MLTLNEHLLNQVLLIAYQAGKHLQQFYQKQVHVELKEDNTPVTEADLFVSQFLTEKLTAL
FPNVPVLSEENCHISFEERKNWKEYWLIDPLDGTQQFINRSDQFSVLITLVRKNKPVLSV
IHAPILSTTYYAMDNFGAFKKQLDQVKKLTKNTTNFDRPLRIAVGATTSQEKVRSILPKD
FPCEFVVVGSSSLKSGLVAEGAVDCYVRLGQTGEWDTAGAEVLLGETHGAIFDSHFEPLT
YNQRETLINPHFVMVGDQSFDWRSIFQFN
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgctgacgctaaacgaacatttacttaaccaagtattgctgattgcttaccaagcaggt
aagcatttgcaacagttttatcaaaaacaggttcatgttgaattgaaagaagacaacacg
cctgtgacggaagcggatctttttgtgagccaatttttgacagaaaaattgaccgcactt
ttccctaatgtccctgttctttcggaagaaaattgtcatatttcctttgaagaacgtaaa
aattggaaagaatattggttgattgatcctcttgatggcacacaacaatttattaatcgt
agcgatcaattttctgtgttgataaccttagttcgtaaaaataaacccgtgttaagtgtt
attcatgcaccaattttatcgacaacttattatgcaatggataattttggcgcatttaaa
aaacaactggatcaggtaaaaaaactcactaaaaacacgacaaattttgaccgcccttta
cgaattgcggtaggtgcaaccacttcacaagaaaaagtgcggtcgattttgccgaaggat
tttccttgtgaatttgttgtggttggttcaagtagcttaaaaagcggtttggtggctgaa
ggtgcagtagattgttatgttcgtttaggacaaacaggcgaatgggatactgctggcgct
gaagtgctactgggtgaaactcacggtgccatttttgactctcattttgagcctttaacc
tataaccaacgcgaaacattgattaatccgcattttgttatggtgggcgatcaatcgttc
gattggcgttctatctttcaatttaattga

DBGET integrated database retrieval system