KEGG   Haemophilus influenzae R2866 (nontypeable): R2866_0071Help
Entry
R2866_0071        CDS       T01981                                 

Gene name
rbsK
Definition
Ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
hiz  Haemophilus influenzae R2866 (nontypeable)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:hiz00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    R2866_0071 (rbsK)
Enzymes [BR:hiz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     R2866_0071 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(74169..75089)
Genome map
AA seq 306 aa AA seqDB search
MRKTLTVLGSINADHVISVPYFAKPGETLTGQNYQIAYGGKGANQAVAAARLGAKVAFIS
CIGSDSIGKTMKNAFAQEGIDTTHINTVSQEMTGMAFIQVAQSGENSIVLASGANSHLSE
MVVRQSEAQIAQSDCLLMQLETPLSGVELAAQIAKKNGVKVVLNPAPAQILSDELLSLID
IITPNETEAEILTGVAVTDEQSAVKAASVFHDKGIKTVMITLGAKGVFVSRKGKSRIIKG
FCVQAIDTTAAGDTFNGGFVTALLEEKSFDEAIHFGQAAAAISVTKKGAQSSIPTRQETL
EFLEHA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaccctcacggttctcggtagtatcaatgctgatcacgttatttctgtgcct
tactttgctaaacccggtgaaacgctaacaggtcaaaattatcaaattgcctatggtggc
aaaggtgccaatcaagcagtggcagccgctcgtttaggggcaaaggtcgcgttcattagt
tgcattggatcagatagcataggcaaaacaatgaaaaatgcgtttgcacaagaaggaatt
gatacaacccatattaataccgtttcacaggaaatgacaggaatggcatttattcaagtt
gcccaatcgggcgagaacagtattgtgctggctagcggtgcaaattcacatttgagtgag
atggttgttcgtcaaagtgaggcgcaaattgcacaatcggattgcttgttaatgcaatta
gaaaccccactttctggtgtggagctggctgctcaaatcgctaagaaaaatggtgtcaag
gttgtgctaaatcctgctccagcgcagattttatcggacgaattattgagtttgattgat
attattacaccaaatgaaacagaagctgaaatcctgacgggggtagcggtaaccgacgaa
caaagtgcggtgaaagctgcgagtgtttttcacgataaaggcattaaaaccgtaatgatt
acccttggtgcgaaaggcgtgtttgtcagtcgaaaaggtaaaagccgcatcattaagggc
ttttgtgtgcaagcaatagatactaccgcagctggtgatacatttaatggcggttttgtt
acggctttattggaagaaaaatcctttgatgaagccattcattttggtcaagctgccgct
gcgattagtgtgacgaaaaaaggggctcaatcctctattccaacgcggcaagaaactttg
gaatttcttgaacacgcttaa

DBGET integrated database retrieval system