KEGG   Haemophilus influenzae R2866 (nontypeable): R2866_0259Help
Entry
R2866_0259        CDS       T01981                                 

Gene name
ruvA
Definition
Holliday junction resolvasome, DNA-binding subunit
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
hiz  Haemophilus influenzae R2866 (nontypeable)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hiz03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
253597..254211
Genome map
AA seq 204 aa AA seqDB search
MIGRLQGILLEKQPPEILLNVQGVGYELLLPMTSFYDLPEIGQETTLFTHLVVREDAHLL
FGFAQKTDRTLFRELIKTNGVGPKLALAILSAMSVEQFAYAIEREELSKLTKIPGVGKKT
AERLLVELKGKFKGVKQSDFFVESTHIPLSPSIESHSESSSDEAISALIALGYKPAEAEK
MVKRVAKPELTSEQVIREALKAAL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtcgcttacaaggcattcttttagaaaaacaacctccagaaattttactcaat
gtgcaaggcgtaggctatgaattgcttttgcctatgacgagtttctatgatttaccagaa
attggacaagaaactactttattcacccatcttgttgttcgggaagatgctcacttactc
tttggatttgcccagaaaacagaccgcactttatttcgtgaattaattaaaacaaatggg
gtggggcctaaattagccttagcgattttatccgccatgtcggtcgaacaatttgcctat
gcaatagagagagaagaactttctaaactcactaaaattccaggtgttggcaaaaaaaca
gctgaacgtttgttagttgaactcaaaggtaaatttaaaggcgtaaaacaaagcgatttc
tttgtagaaagtacgcatattccattatccccatctattgaatcccactcggaaagttca
tctgatgaagcaatttcagccttgattgctttaggttataaacctgcagaagcagaaaaa
atggtaaaacgcgttgctaaacctgaattaaccagtgaacaagttattcgtgaagcatta
aaagccgcattgtag

DBGET integrated database retrieval system