KEGG   Haemophilus influenzae R2866 (nontypeable): R2866_0500Help
Entry
R2866_0500        CDS       T01981                                 

Gene name
dapE
Definition
N-succinyl-diaminopimelate deacylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
hiz  Haemophilus influenzae R2866 (nontypeable)
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hiz01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:hiz00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
506130..507263
Genome map
AA seq 377 aa AA seqDB search
MREKVVSLAQDLIRRPSISPNDEGCQQIIAERLEKLGFQIEWMPFNDTLNLWAKHGTSEP
VIAFAGHTDVVPTGDENQWSSPPFSAEIIDGMLYGRGAADMKGSLAAMIVAAEEYVKANP
NHKGTIALLITSDEEAAAKDGTIRVVETLMTRDEKITYCMVGEPSSAKNLGDVVKNGRRG
SITGNLYIQGIQGHVAYPHLAENPIHKAAPFLQELTTYQWDKGNEFFPPTSLQIANIHAG
TGSNNVIPAELYIQFNLRYCTEVTDEIIKQKVAGMLEKHNLKYRIEWNLSGKPFLTKPGK
LLDSITSAIEETIGITPKAETGGGTSDGRFIALMGAEVVEFGPLNSTIHKVNECVSVEDL
GKCGEIYHKMLVNLLDS
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgagagaaaaagtggtttcgttggcgcaagatttaattcgtcgcccgtctattagccct
aatgacgaaggctgtcagcaaattattgccgaacgtttagaaaagttaggttttcaaatt
gaatggatgccttttaatgatacgctgaatttgtgggcaaaacacggaacgagcgagcca
gttattgcttttgcaggtcatacggatgttgtgcctactggcgatgaaaatcaatggtcg
tctccgccgttttctgcggagattattgatggcatgctttatgggcgtggtgcggcggat
atgaaaggctcccttgcagcaatgattgtggcggcagaagaatacgtaaaagcaaatcct
aatcataaaggcaccattgcattattgattacctctgatgaagaggctgccgcaaaagat
ggaactatacgcgtggttgagacgttaatgacgcgtgatgaaaaaattacttattgtatg
gttggcgagccatcaagtgctaaaaacttaggcgatgttgtcaaaaatggtcgccgcggc
tcaattacaggaaatctctatattcaaggtattcaaggacacgtagcctatccgcattta
gctgaaaacccaatccataaagcagcgccatttttgcaagaattaacgacttaccaatgg
gataaaggcaatgaatttttcccgccaacaagcctacaaattgctaacattcacgcgggt
acgggaagtaataatgtaattcctgctgagttatatattcagttcaatttgcgttattgc
acagaagtcacggatgaaatcattaagcaaaaagtggctggaatgctagaaaaacacaat
ttgaaatatcgtattgaatggaatttatcaggcaaaccctttttaacaaaaccaggtaaa
ttattagattcgataacctccgctattgaggaaaccataggcataacgccaaaggctgaa
acaggtggcggcacgtcagacggtcgttttattgcattgatgggcgcagaagtagtggaa
tttggtccgttaaattcaaccattcataaagtcaatgaatgtgtcagtgtagaagacctt
ggcaagtgcggtgaaatttaccacaaaatgttagtgaatttattggatagctaa

DBGET integrated database retrieval system