KEGG   Haemophilus influenzae R2866 (nontypeable): R2866_0908Help
Entry
R2866_0908        CDS       T01981                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
hiz  Haemophilus influenzae R2866 (nontypeable)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hiz00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
929757..930569
Genome map
AA seq 270 aa AA seqDB search
MKTTLLKTLTPELNLVQHNDIPVLHLKHAVGTAKISLQGAQLISWKPQNAKQDVLWLSEV
EPFKNGNAIRGGVPICYPWFGGVKQPAHGTARIRLWQLSHYYISVHKVRLEFELFSDLNI
IEAKVSMVFTDKCHLTFTHYGEEPAQAALHTYFNIGDINQVEVQGLPETCFNSLNQQQEN
IPSPRHIYENVDCVYSAENMQNQILDKSFNRTIALHHHNASQFVLWNPWHKKTKGMSETG
YQTMLCLETARIHHLLEFGESLSVEISLKG
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaacattactaaaaacactgacaccagagcttaatcttgttcaacataacgac
attccagttcttcacttaaaacatgctgttggaacagcaaaaatttccctgcaaggggca
cagcttatcagttggaaaccgcaaaatgcgaagcaagatgtattatggctaagtgaagta
gagccattcaaaaatggcaatgctattcgtggtggtgtaccgatttgttatccttggttt
ggtggcgtaaaacaacctgcgcacggtacagctcgtattcgtttatggcagttgagtcat
tactatatttcagtgcataaagtgcggttagaatttgagttgttttctgatttaaatatt
atcgaagctaaagtctcaatggtatttacagataaatgtcatttaacttttacccattat
ggcgaagaaccagcccaagcagcattacatacctattttaatattggggatattaatcaa
gtggaagtacaaggtttacctgaaacttgttttaatagcttaaaccaacaacaagaaaat
attccgtcaccgcgtcacatttatgaaaatgttgattgcgtttattccgcagaaaacatg
cagaatcaaatcctagataaaagtttcaatcgtacaattgcactgcatcatcataatgca
agtcaatttgtcctttggaatccttggcacaaaaagacgaaaggaatgagtgaaactggc
tatcaaacgatgttgtgcttagaaactgcacgtatccatcacttgcttgaatttggcgaa
agtttaagcgtagaaatttcgcttaaaggctaa

DBGET integrated database retrieval system