KEGG   Haemophilus influenzae R2866 (nontypeable): R2866_0913Help
Entry
R2866_0913        CDS       T01981                                 

Gene name
recD
Definition
Exodeoxyribonuclease V, alpha subunit (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
hiz  Haemophilus influenzae R2866 (nontypeable)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hiz03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
935819..937741
Genome map
AA seq 640 aa AA seqDB search
MLSVLQKLKEQGILSQGDYYFAKLIADKQCHADYAEPVKNLAILLAALCSWRYTQGNTCS
QLDRYLEHNLFGLAYRTTEEDYLAEIREKIGYLAVEDWQNALRGHMAFTQDPVNQIAPMA
FQFGALYFYRAWQDEYRIAQYIKNTLKKHRTLAFSYDEIHQKLEKYFPEKQEKTDWQKVA
VATAIKSPFSIITGGPGTGKTTTVTRLLLVLQELFDCKLHIKLVAPTGKAASRLEESIKN
ALGFMQEKMNLSHSLFNAIPQKASTLHSLLGVNAFNDYTRYNSHNPLQLDVLVVDETSMI
DLPMMAKLINALKPETRLILLGDQAQLASVEAGAVLGELAQFVTQPYSHEQAAYLLATTG
YKVEGSDCSNPIRDCLCHLTESRRFDKDSGIGKLAEFIQKGKADDSLELFDHYPQELHFN
ALNDESNAVNQVVKSAVENYRTFLKMLDDLRKQKIDPNAKNEQGISYAEAIQSQFNSVRF
LTALRNNNLGVENLNKEIALALREQKLLWFRNEQDWYIGKPIMITENDHNVRLYNGDIGL
CLANGKVWFGNREVLTSRIPAHEPAFMMTIHKSQGSEFEHTVMVLPTEVNPVLSRELVFT
GVTRAKKELTVFADEKIWKTAIRQTVKRQSGLGKLLEDLN
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgttatccgtattacaaaaacttaaagagcagggcattctttctcaaggtgattattat
tttgctaagttgatagctgataaacaatgtcatgcggattatgcggaaccagtcaaaaat
ttagccatattattagccgcactttgtagctggcgttatacgcagggaaatacttgcagc
caattagatcgctatttagaacataatttatttggtttggcttatcgtacaacggaagaa
gattatttagcagaaattcgtgaaaagattggttatttagctgtggaagattggcaaaat
gcattgcgcgggcatatggcatttacgcaagatcctgtcaatcaaattgcgccaatggca
tttcaatttggcgcgttgtatttctatcgcgcttggcaagatgaatatcgcatcgcacaa
tatataaaaaacaccttaaaaaaacaccgcactttagccttttcttatgatgaaattcat
caaaaattagagaaatatttccctgaaaaacaggaaaaaacagattggcaaaaagtggca
gtggcgacagcgattaaaagtccattttcgattattacaggcggcccaggaacaggaaaa
accacgacagttacgcgtttattgctcgttctacaagaattatttgattgtaaattacac
atcaaattggttgcgccgactggcaaagccgcctcccgtttggaagagtcgattaaaaat
gcgttaggttttatgcaagaaaaaatgaatttatcccattcacttttcaatgcgattcca
caaaaagccagcaccttgcatagtttactgggcgtgaatgcctttaatgattacacacga
tataacagccataaccctttgcagttagatgtattagttgttgatgaaacatcaatgatt
gatttgccgatgatggcaaaacttatcaatgcgttaaagcccgaaacccgattaatttta
ttaggcgatcaggcacaattagcctctgttgaggcgggggctgtattgggggaattggct
caatttgttactcaaccttatagtcatgaacaagccgcatacttactagcaacaacaggc
tacaaagtagaaggttccgattgttcaaatccaatacgtgattgcttatgccatctaaca
gaaagtcgccgttttgataaagattcaggcattggcaagttggctgaattcattcaaaaa
ggcaaagcagacgatagccttgagttatttgaccattatccgcaagaattgcactttaat
gctttaaatgatgaaagcaatgcggttaatcaagtggtgaaaagtgcggtggaaaattac
cgcactttcttaaaaatgttggacgatttacgtaaacaaaaaattgatcctaacgctaaa
aatgaacaaggcatttcctatgccgaagctattcaatcgcaatttaattctgtgagattt
ttaaccgcacttcgtaataacaatttaggtgtcgaaaatctcaataaagaaattgcgtta
gcgttgcgagagcaaaaattgctttggttccgtaatgaacaagattggtatatcggcaag
ccaattatgattactgaaaatgatcataacgttcgcctttataacggcgatattggactt
tgcttggcaaatggcaaagtatggtttggcaatcgagaagtgctgacaagccgaattcca
gcgcacgaacccgcttttatgatgacgattcataaatctcaaggttccgaatttgaacat
accgtcatggtgcttccaacagaagtaaatccagtactgtcgcgagaattagttttcacg
ggcgtgactcgtgcgaaaaaagaactcactgtatttgccgatgaaaaaatatggaaaaca
gcaattcgccagaccgtcaaacgccagagcggattgggaaaattattggaagatttaaat
tag

DBGET integrated database retrieval system