KEGG   Haemophilus influenzae R2866 (nontypeable): R2866_0925Help
Entry
R2866_0925        CDS       T01981                                 

Gene name
folP
Definition
7,8-dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hiz  Haemophilus influenzae R2866 (nontypeable)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hiz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    R2866_0925 (folP)
Enzymes [BR:hiz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     R2866_0925 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
948418..949245
Genome map
AA seq 275 aa AA seqDB search
MKLYANNKCLDLSVPQIMGILNFTPDSFSDSGQFFSLDKALFQVEKMLEEGATIIDIGGE
STRPNADEVSEQEELHRVVPVVEAVRNRFDCWISVDSSKAVVMREAANVGMDLINDIRAL
QEPNALETAVKLALPVCIMHMQGQPRTMQANPYYENVVQDVLAFLQKRTNECLSAGIKKE
NLIWDMGFGFGKSVQHNYQLLQNLNEFCKNGYPVLAGLSRKSMIGAVLDKPVDQRIIGSA
AGALIAAQKGAKILRVHDVAATSDMLKVWQATENA
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaaactttacgcaaataataaatgtcttgatttaagcgtgcctcaaattatggggatt
cttaattttacgcctgattctttttctgatagcggacagttttttagtctagataaagca
ctttttcaagttgaaaaaatgctagaagagggggcgacaattattgatattggtggagaa
tccactcgtccgaatgcggatgaagtttctgaacaagaggaattgcatcgtgttgtgcca
gtagtggaggcggtgcgaaaccgttttgattgctggatttctgttgattcctcaaaagct
gttgtgatgcgtgaagcggcaaatgttggaatggatttgattaatgatattcgtgctttg
caagagccgaatgcgttagaaacggcggtaaaactggctttacctgtttgtattatgcat
atgcaagggcaacctcgcacgatgcaagcaaatccttattatgaaaatgtcgtgcaagat
gtattggcttttttacaaaaacgtactaatgaatgcctttctgctggcattaaaaaagaa
aatttaatttgggatatgggctttggctttggcaaatctgtacagcataattatcaatta
ttacaaaatctgaatgaattttgtaagaatggctatccagtattagcgggattatctcgc
aaatcaatgattggcgcagtgcttgataaaccggttgatcaaagaataattggcagtgcg
gcaggcgcgcttattgcagcgcaaaaaggtgcaaaaattttacgcgtacatgatgttgct
gcaacatcagatatgctcaaagtttggcaggcaacagaaaatgcctga

DBGET integrated database retrieval system