KEGG   Haemophilus influenzae R2866 (nontypeable): R2866_0960Help
Entry
R2866_0960        CDS       T01981                                 

Gene name
trpB
Definition
Tryptophan synthase, beta subunit (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hiz  Haemophilus influenzae R2866 (nontypeable)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hiz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    R2866_0960 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    R2866_0960 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    R2866_0960 (trpB)
Enzymes [BR:hiz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     R2866_0960 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(975879..977075)
Genome map
AA seq 398 aa AA seqDB search
MSDTLLNPYFGEFGGMYVPEILVPVLKQLEQAFVEAQNDPTFQAEFVDLLKNYAGRPTAL
TLCRNLTKGTKTKLYLKREDLLHGGAHKTNQVLGQILLAKRMGKTRIIAETGAGQHGVAT
ALACAMLDMPCRVYMGAKDVERQSPNVFRMRLMGAEVIPVQKGSCSLKDACCEAMRDWSA
NYETTHYLLGTAAGPHPFPTIVREFQKMIGEETKRQILEREGRLPDAVIAAVGGGSNAIG
MFADFIDESNVRLIGVEPAGKGIETGEHGAPLKHGTTGIYFGMKSPIMQDKDGQIEESYS
ISAGLDFPSVGPQHAYLNEIGRADYVSITDEEALNAFQELAKHEGIIPALESSHALAYAL
KLIKQNPEKEQLLVVNLSGRGDKDIFTVDKILTEKGMK
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacacacttcttaacccttattttggcgaatttggcggaatgtatgtacccgaa
attttagtgcctgttttaaagcaattagaacaagcctttgtggaggctcaaaatgatcct
acattccaagcagaatttgttgatttactcaaaaattatgcgggcagaccgaccgcactt
actctttgtcgtaacttaactaaaggtacaaaaactaaactttatcttaaacgtgaagat
ttattacacggtggtgcacacaaaaccaaccaggtgttagggcaaattttattggctaaa
cgtatgggcaaaacgcgtattattgccgaaacaggtgcgggtcagcacggtgttgcgacc
gccctagcttgtgctatgttagatatgccgtgtcgtgtttatatgggtgcaaaagatgtt
gagcgtcaatcaccaaacgtgttccgtatgcgtttaatgggggctgaagtaattcctgta
caaaaaggctcttgttctttaaaagatgcctgttgtgaagcgatgcgtgattggtcagca
aactatgaaaccacccattatttacttggaaccgctgcaggccctcaccctttcccgacg
attgtgagagaatttcaaaaaatgattggcgaagaaaccaaacgtcaaattctcgaacgg
gaaggtcgtttacctgatgctgtcattgctgctgttggcggtggttcgaatgcaattggt
atgtttgctgattttattgatgaatcaaatgtgcgtttaattggtgttgagcctgcgggt
aaaggtattgaaacgggcgaacacggtgcaccgctcaagcacggcacaacaggcatctac
ttcggaatgaaatcgccaattatgcaagataaagatggacaaattgaagaatcctactcc
atttctgcagggttagattttccctctgtcgggccgcaacatgcttatttaaatgagatt
ggtcgtgctgattatgtatcgattaccgatgaagaagccctcaacgcattccaagaattg
gcaaaacatgaaggcattatccctgcattagaaagctcacacgccttggcttatgccttg
aaattgattaaacaaaatcctgaaaaagaacaacttttagtggttaatctttcaggacga
ggcgataaagatatttttaccgttgataaaattttgacagaaaaaggaatgaaataa

DBGET integrated database retrieval system