KEGG   Haemophilus influenzae R2866 (nontypeable): R2866_1010Help
Entry
R2866_1010        CDS       T01981                                 

Gene name
trpCF
Definition
(GenBank) Indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
hiz  Haemophilus influenzae R2866 (nontypeable)
Pathway
hiz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hiz01100  Metabolic pathways
hiz01110  Biosynthesis of secondary metabolites
hiz01130  Biosynthesis of antibiotics
hiz01230  Biosynthesis of amino acids
Module
hiz_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hiz00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    R2866_1010 (trpCF)
Enzymes [BR:hiz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     R2866_1010 (trpCF)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     R2866_1010 (trpCF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ADO80955
Position
complement(1012713..1014146)
Genome map
AA seq 477 aa AA seqDB search
MMITQDFTKPIDSATVLQKIILDKAQWVKAKEKEFPLSQFKQNIQNSDRSFYDALAKGTH
QKPTYILECKKASPSKGLIRAEFNLEEIANVYKHYASAVSVLTDEKYFQGNFEFLPLVRD
IVSQPVLCKDFMISEYQVYLARYYQADAILLMLSVVNDETYRVLAELAHSLGMGVLTETS
NEEEFERALALGAKIIGVNNRNLHDLTVDLNRVVELTEKYADCIPADVRIISESGIYNHK
QIHQLQKVAHGFLIGSSLMSNQDLNNAVRSVIFGENKVCGLTRAQDVKIVYENGALYGGL
IFVEHSKRCVSLRQAQELVTAAPLRFVGVFQNQEIDFIVKIANQLQLYAVQLHGAETEAF
ITALRQQLPKNTQIWKAISVNTEAQSAVDFTDDLNVDRYIFDSQTANQQGGTGKTFDWSL
IPENLKHKIILAGGISPNNVEQAIQQNCLGLDINSGVESSAGVKDQEKVRLVFNNIY
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgatgattactcaagattttactaaacccattgattccgctacggtgctacaaaaaatc
atcttagacaaagcgcaatgggttaaagcaaaagaaaaggaatttcccctttcacaattt
aaacaaaacattcaaaactctgaccgctctttttatgatgcgttagcaaaaggtacgcat
caaaagcccacttacattttggaatgtaaaaaagcctccccttctaagggattaattcgt
gctgaatttaatttggaagaaatcgccaatgtctataaacattatgcgtccgctgtatct
gttctgacagatgaaaaatactttcaagggaattttgaattcttgcctttagttcgcgat
atcgtaagccaacctgtgctttgcaaagattttatgattagcgaatatcaagtttacctt
gctcgctactatcaagcggatgcaattttattaatgctttctgtggtaaatgatgaaact
tatcgtgtgctggcagagcttgcacattctcttggtatgggtgtattgacagaaaccagc
aatgaagaagaatttgaacgcgcccttgcactgggtgcaaaaattattggtgtcaataat
cgtaacttgcacgatttaactgtggatttaaatcgtgttgttgaactcactgaaaaatac
gccgactgtattcctgctgatgtacgtattattagcgaatcaggcatttacaatcacaag
caaattcatcaattacaaaaagtggcacatggtttcttaattgggagcagcttaatgagc
aaccaagatttgaataatgcggttcgctcggtaatttttggagaaaataaagtatgcggt
ttaacgcgcgcgcaagatgtcaaaatcgtttacgaaaacggggcactttacggcggatta
atcttcgtagaacattcaaaacgttgtgtgagtttacgccaagcgcaagaattagtaacc
gctgctccacttcgatttgttggtgtttttcagaatcaagaaattgactttatcgtcaaa
atagccaaccaattacagctttatgcggtgcaattacatggtgcagaaactgaggcattt
attaccgcacttcgccaacaactaccaaaaaacacgcaaatctggaaagcaatttcggtc
aatactgaagcccaaagtgcggttgattttacagatgatttgaatgtggatcgttatatt
tttgatagccaaacagcgaaccaacaaggtggcacgggtaaaacctttgattggtcatta
attcctgaaaatcttaaacacaagattattttagctggcggcatttcaccaaataatgtg
gaacaagccattcaacaaaattgcttaggcttggatattaattctggggtggaaagttct
gctggcgtaaaagatcaagaaaaagtgcggttagtttttaataatatttattaa

DBGET integrated database retrieval system