KEGG   Haemophilus influenzae R2866 (nontypeable): R2866_1138Help
Entry
R2866_1138        CDS       T01981                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hiz  Haemophilus influenzae R2866 (nontypeable)
Pathway
hiz00900  Terpenoid backbone biosynthesis
hiz01100  Metabolic pathways
hiz01110  Biosynthesis of secondary metabolites
hiz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hiz00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    R2866_1138 (ispE)
Enzymes [BR:hiz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     R2866_1138 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ADO81080
Position
1159200..1160141
Genome map
AA seq 313 aa AA seqDB search
MKSHQFSTALCQNTTQSNGQPLRFPSPAKLNLFLYINGKLPNGYHELQTLFQFLDFGDWL
DISIREQDNQIVLTPEIPNLKTENNLIYRAAKLLQEKANIQLGANIHLDKILPMGGGVGG
GSSNAATALVSLNYLWQANLSIDELAKLGLTLGADVPIFVHGHAAFAEGVGEKITYCEPA
EKWFVILKPDDSISTAVIFQDPNLPRNTPKKSLEQLLSEPYKNDCEKVVINHYSNVEKAL
NWLLQYAPARLTGTGACVFAEFDHEAEAQAVFRQKPEAFFGFIAKGLNVSPLHAMLKQLS
STHTHRQSKPEVL
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcacatcaattttctaccgcactttgccaaaatacaacacaatcaaatgggcag
ccattacgcttccctagcccagcaaaactgaatttatttctttatatcaatggaaaattg
ccgaacggctatcatgaattacaaacgcttttccaatttttagattttggcgattggtta
gacattagtattcgggaacaagataatcaaattgttttaacgccagaaattccaaatcta
aaaacggaaaataatctaatttatcgagctgcaaaacttttacaagaaaaagccaatatt
caattgggtgcaaatattcatttagataaaattcttccaatgggagggggggttggtggt
ggttcatccaatgcagcaaccgcattagtctctttaaattatttatggcaagccaattta
tccattgatgaactagcaaaattgggattaacattaggcgcggatgtgccaatatttgta
catggacacgcagcttttgctgaaggcgtcggggaaaaaatcacttattgtgaacctgcc
gaaaaatggtttgttatattaaaacccgatgattcaatatcgacggctgtgatatttcaa
gatccaaatttaccacgtaatacaccgaaaaaatccctcgaacaacttttgagtgaacct
tataaaaacgattgcgaaaaagttgtgataaatcattattcaaacgttgaaaaagcgtta
aactggttgctacaatatgcgccggcaagattaacaggaacgggagcctgtgtttttgct
gaatttgatcatgaagcagaagcgcaagcggtatttagacaaaaaccagaagcatttttt
ggtttcatcgctaaaggactcaatgtgtctcccttgcacgcaatgttgaagcagctatca
tcaactcatactcatagacaatctaaacctgaggttttataa

DBGET integrated database retrieval system