KEGG   Haemophilus influenzae R2866 (nontypeable): R2866_1138Help
Entry
R2866_1138        CDS       T01981                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hiz  Haemophilus influenzae R2866 (nontypeable)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:hiz00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1159200..1160141
Genome map
AA seq 313 aa AA seqDB search
MKSHQFSTALCQNTTQSNGQPLRFPSPAKLNLFLYINGKLPNGYHELQTLFQFLDFGDWL
DISIREQDNQIVLTPEIPNLKTENNLIYRAAKLLQEKANIQLGANIHLDKILPMGGGVGG
GSSNAATALVSLNYLWQANLSIDELAKLGLTLGADVPIFVHGHAAFAEGVGEKITYCEPA
EKWFVILKPDDSISTAVIFQDPNLPRNTPKKSLEQLLSEPYKNDCEKVVINHYSNVEKAL
NWLLQYAPARLTGTGACVFAEFDHEAEAQAVFRQKPEAFFGFIAKGLNVSPLHAMLKQLS
STHTHRQSKPEVL
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcacatcaattttctaccgcactttgccaaaatacaacacaatcaaatgggcag
ccattacgcttccctagcccagcaaaactgaatttatttctttatatcaatggaaaattg
ccgaacggctatcatgaattacaaacgcttttccaatttttagattttggcgattggtta
gacattagtattcgggaacaagataatcaaattgttttaacgccagaaattccaaatcta
aaaacggaaaataatctaatttatcgagctgcaaaacttttacaagaaaaagccaatatt
caattgggtgcaaatattcatttagataaaattcttccaatgggagggggggttggtggt
ggttcatccaatgcagcaaccgcattagtctctttaaattatttatggcaagccaattta
tccattgatgaactagcaaaattgggattaacattaggcgcggatgtgccaatatttgta
catggacacgcagcttttgctgaaggcgtcggggaaaaaatcacttattgtgaacctgcc
gaaaaatggtttgttatattaaaacccgatgattcaatatcgacggctgtgatatttcaa
gatccaaatttaccacgtaatacaccgaaaaaatccctcgaacaacttttgagtgaacct
tataaaaacgattgcgaaaaagttgtgataaatcattattcaaacgttgaaaaagcgtta
aactggttgctacaatatgcgccggcaagattaacaggaacgggagcctgtgtttttgct
gaatttgatcatgaagcagaagcgcaagcggtatttagacaaaaaccagaagcatttttt
ggtttcatcgctaaaggactcaatgtgtctcccttgcacgcaatgttgaagcagctatca
tcaactcatactcatagacaatctaaacctgaggttttataa

DBGET integrated database retrieval system