KEGG   Haemophilus influenzae R2866 (nontypeable): R2866_1190Help
Entry
R2866_1190        CDS       T01981                                 

Gene name
dsbC
Definition
Protein disulfide isomerase II (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hiz  Haemophilus influenzae R2866 (nontypeable)
Brite
Enzymes [BR:hiz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     R2866_1190 (dsbC)
Secretion system [BR:hiz02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   R2866_1190 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1211925..1212614)
Genome map
AA seq 229 aa AA seqDB search
MKKIFTALLCVAAANAMADDAAIKRKLQSFNISNIVIKSSPISGIKTAVTDQGILYVSED
GKYLFEGKLYELTNNGPIDVAGKILVDKLNSYKDEMIVYPAKNEKHVVTVFMDITCHYCH
LLHQQLKEYNDLGITVRYLAFPRAGMNNQTAKQMEAIWTAKDPVFALNEAEKGNLPKEVK
TPNIVKKHYELGIQFGVRGTPSIVTSTGELIGGYLKPADLLRALEETAQ
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatttttaccgcacttttgtgcgtggctgcggctaatgcaatggcagatgat
gcggcaattaaacgcaaattacagtcttttaatatatcaaatattgttattaaatcttcg
ccgatttcaggcattaaaacggctgtcacggatcaaggtatactctatgtgagcgaagat
ggaaaatatctttttgaaggtaaactttatgaactcacaaataatggccctattgatgtc
gcaggtaaaattttagtggataaacttaattcttataaagatgagatgattgtttatcct
gcgaaaaatgaaaaacacgtagtaacagtatttatggatattacctgccattattgccat
ttgttacatcagcaattaaaagaatataacgatcttggtattactgtgcgttacttagct
ttccctcgcgcaggtatgaataatcaaacggcgaaacaaatggaagcgatttggacggcg
aaagatcccgtttttgctttaaatgaagcagaaaaaggcaatttaccaaaagaagttaaa
acgccaaatatcgtgaaaaaacattatgaattaggtattcaatttggtgtacgaggaaca
ccaagtattgttacctcaactggtgagcttattggcggttatttaaaaccagctgattta
ttaagagcacttgaagaaacagcacaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system