KEGG   Haemophilus influenzae R2866 (nontypeable): R2866_1483Help
Entry
R2866_1483        CDS       T01981                                 

Gene name
folA
Definition
Dihydrofolate reductase (DHFR) (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
hiz  Haemophilus influenzae R2866 (nontypeable)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hiz00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:hiz00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1524820..1525302
Genome map
AA seq 160 aa AA seqDB search
MTFSLIVATTLNNVIGKDNQMPWHLPADLAWFRQNTTGKPVIMGRKTFESIGRPLPKRTN
IVLSRQLFEHEGVIWKDSFESAVNFVRDFDEIMLIGGGELFKQYLPKADKLYLTQIQTEL
DGDTFFPQLNWEEWEIEFDEYRKADEQNRYDCRFLILTRK
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacatttagtttaattgtggcgacaacattaaataatgtgattggtaaagataaccaa
atgccttggcacttgcctgcagatttagcttggtttcgtcagaacaccactggtaaacct
gtcattatggggcgtaaaacctttgaaagtattggtcgtccactacctaaacgtaccaat
atcgtactttctcgccagctttttgaacacgaaggtgtgatatggaaagatagctttgaa
agtgcggtcaattttgtcagagattttgatgaaattatgttgattggtgggggagagtta
ttcaaacaatatttgcccaaagcagataagttataccttactcaaattcaaacagaacta
gatggcgatacttttttccctcaattgaattgggaggagtgggaaattgaatttgatgaa
tatcgtaaggcagatgaacaaaatcgctatgattgccgatttttaattcttacccgaaaa
taa

DBGET integrated database retrieval system