KEGG   Haemophilus influenzae R2866 (nontypeable): R2866_1525Help
Entry
R2866_1525        CDS       T01981                                 

Gene name
fpg2
Definition
Formamidopyrimidine-DNA-glycosylase 2
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
hiz  Haemophilus influenzae R2866 (nontypeable)
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:hiz03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1571057..1571869)
Genome map
AA seq 270 aa AA seqDB search
MPELPEVETTKNGISPYLEGAIIEKIVVRQPKLRWMVSEELAQITQQKVIALSRRAKYLI
IQLETGYMIGHLGMSGSLRVVEKGDLIDKHDHLDIVVNNGKVVRYNDPRRFGAWLWTEKL
NEFPLFLKLGPEPLSEEFDSDYLWQKSRKKQTALKTFLMDNAVVVGVGNIYANETLFLCN
LHPQKTAGSLTKAQCGQLVEQIKQVLSNAIQQGGTTLKDFLQPDGHPGYFVQELRVYGNK
DKPCPTCGTKIESLVIGQRNSFYCPKCQKR
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgccagaattacctgaagttgaaaccacaaaaaatggaattagcccttatcttgaaggg
gctatcattgaaaaaattgttgttcgccaaccgaaattacgctggatggtaagcgaagaa
ttagcgcaaattacacaacaaaaagtcatcgcattaagtcgccgtgcgaagtatttaatt
atccaacttgaaacaggctatatgattggacatttagggatgtcagggtcattgagagtt
gtggagaaaggggatcttattgataaacatgatcatcttgatatcgtagtgaataacgga
aaagttgtgcgttataacgatcctcgtcgttttggcgcgtggttatggacagagaagttg
aacgaatttcctctttttctgaaattaggcccagagcctctgtctgaggaatttgattct
gattacttgtggcaaaaaagtcgtaaaaaacagaccgcacttaaaacttttttaatggat
aatgctgtcgtcgttggcgttgggaatatctatgcgaatgaaacgttatttctttgtaac
ctacatccgcaaaaaacagcagggagtttaactaaggcacaatgtgggcagttagtagaa
caaataaaacaagtgctgtctaacgcaatccaacaaggtggtacgacgctaaaagatttt
ctccaaccggatgggcatccaggctattttgtccaagaattgcgggtttatggtaataag
gataagccttgtccaacatgtggcacaaaaatagaaagtttagtgatagggcaacgaaat
agtttctattgccccaagtgtcagaagagataa

DBGET integrated database retrieval system