KEGG   Haemophilus influenzae R2866 (nontypeable): R2866_1581Help
Entry
R2866_1581        CDS       T01981                                 

Gene name
galU
Definition
Glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hiz  Haemophilus influenzae R2866 (nontypeable)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hiz00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    R2866_1581 (galU)
   00052 Galactose metabolism
    R2866_1581 (galU)
   00500 Starch and sucrose metabolism
    R2866_1581 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    R2866_1581 (galU)
Enzymes [BR:hiz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     R2866_1581 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1626013..1626900
Genome map
AA seq 295 aa AA seqDB search
MKAIIPVAGLGTRMLPATKAIPKEMLTLVDKPLIQYVVNECVAAGIKEIVLVTHSSKNAI
ENHFDTSFELETMLEKRVKRQLLEEVRSICPKNVTIMHVRQGNAKGLGHAVLCGRPLVGN
ESFAVMLPDVLLAEFSADQKKENLAAMIQRFNETGASQIMVTPVPQENVSSYGVADCGGI
ELNGGESAKINSIVEKPSIEDAPSNLAVVGRYVFSAAIWDLLEKTPIGVGDEIQLTDAID
MLIEKETVEAFHMTGETFDCGDKIGYMEAFVEYGIRHEKLGKEFKSFIKNLAKTL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaattattcctgtcgccggtcttggcacacgtatgttgcccgccacgaaggcg
attccgaaggaaatgctcactttggtggataaaccgttaattcaatacgtggtaaatgaa
tgtgtagctgctggcataaaagaaattgtgctggtaacacattcatcaaaaaatgctatc
gaaaaccattttgatacatcttttgaattagaaacaatgctggaaaaacgtgtgaagcgt
cagcttctagaagaagttcgttctatctgtccaaaaaatgtaaccattatgcacgttcgt
caaggtaatgcgaaaggtttaggtcacgccgtgttatgcggtcgtcctttagtaggaaat
gaatcttttgccgttatgttaccagatgtattattagctgaatttagtgcagatcagaaa
aaagaaaatcttgctgcaatgattcaacgctttaatgaaactggcgcaagccaaattatg
gtaaccccagttccgcaagaaaatgtgagtagctatggtgttgcagattgtggtggcatt
gagcttaatggcggcgaaagtgcaaaaattaatagtattgttgaaaaaccttctattgaa
gacgcaccatcaaatcttgctgtggttgggcgttatgttttttcagcagcaatttgggat
ttgttagaaaaaacaccaattggtgttggcgatgaaatccaattaaccgatgctattgat
atgctaattgaaaaagaaaccgttgaagcatttcatatgacaggggaaacttttgattgt
ggcgataaaattggttatatggaagctttcgtagaatatggtattcgtcacgaaaaatta
ggtaaagaatttaaatcctttatcaaaaatttggcaaaaacgctataa

DBGET integrated database retrieval system