KEGG   Haemophilus influenzae R2866 (nontypeable): R2866_1687Help
Entry
R2866_1687        CDS       T01981                                 

Gene name
fucA
Definition
L-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hiz  Haemophilus influenzae R2866 (nontypeable)
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hiz00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1729498..1730148
Genome map
AA seq 216 aa AA seqDB search
MNRAELSQKIIDTCLEMTKLGLNQGTAGNVSVRYKDGMLITPTGMPYHLMKTENIVYVDG
NGKHEENKLPSSEWQFHLSVYHTRPEANAVVHNHSIHCAGLSILEKPIPAIHYMVAVSGT
DHIPCVPYATFGSHELASYVATGIKESKAILLAHHGLITCGENLDKALWLAQEVEVLASW
YLKLLSTGLEIPLLSKEQMQVVLGKFHTYGLRIEES
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgaacagagcagaattatcacaaaaaatcattgatacttgtcttgaaatgacaaaatta
ggtttaaatcaaggcacagcgggaaacgttagtgttcgttataaagatggaatgctgatt
accccgacaggtatgccatatcacttaatgaagacagaaaatattgtttatgttgatgga
aatggcaaacacgaagaaaataaattaccatcaagcgaatggcaatttcacttgagtgtt
tatcatactcgccctgaagcaaatgccgttgtccacaatcattccattcactgtgcaggc
ttatccattctcgaaaaacctattcctgcaattcattacatggtagccgtaagcggcaca
gatcatattccttgtgtaccttatgcaacatttggtagtcacgaattagctagttatgtc
gcaacgggaatcaaagaaagcaaagccattttactagcacaccatggtttaatcacttgc
ggagaaaacctagataaagccttatggctcgcacaagaagtagaagtattagcgtcttgg
tatttgaaattactctctacaggcttagaaattccactgctcagcaaagagcaaatgcag
gtagtgttaggtaaattccacacctatggattacgtattgaagaatcctaa

DBGET integrated database retrieval system