KEGG   Haemophilus influenzae R2866 (nontypeable): R2866_1708Help
Entry
R2866_1708        CDS       T01981                                 

Definition
Probable bacteriophage lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
hiz  Haemophilus influenzae R2866 (nontypeable)
Brite
Enzymes [BR:hiz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     R2866_1708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1750597..1751115
Genome map
AA seq 172 aa AA seqDB search
MIKRSAKYICAISAVVGLVIASHGNEIRTSEKGLLLIGNAEGCMKKPYQCPADVLTVGIG
ITDAVEKIDRNKIYTLQEIAELYVKGIKQSEKCVNQYANGKTMPQGAFDALVSITFNVGC
GKLKNSSLFKMARQGYSKAMCGQFERWIYAAGKPLKGLIERRQKEKNLCLIS
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgattaaacgttccgccaaatacatctgcgccatatccgccgttgttggacttgtgatt
gcctctcatggaaatgaaattcgaacatccgaaaaaggcttgttactgattggcaatgca
gaaggttgtatgaaaaagccctatcaatgccctgccgatgttttaacagtcggcataggc
ataaccgatgccgttgaaaaaattgaccgcaataaaatttacaccttgcaagaaattgcc
gaattatacgtaaaaggcattaaacaatcagaaaaatgcgttaatcaatatgccaacggg
aaaaccatgccacaaggtgcatttgatgccctcgtctccatcacctttaacgtaggatgc
ggcaaattaaaaaatagctcactttttaaaatggcacgccaaggctacagcaaagccatg
tgcggtcaattcgaacgttggatttatgcagcaggaaaaccgctaaaaggattaattgaa
cgccgtcaaaaggagaaaaacctatgtttaatttcttaa

DBGET integrated database retrieval system