KEGG   Haemophilus influenzae R2866 (nontypeable): R2866_1776Help
Entry
R2866_1776        CDS       T01981                                 

Gene name
mod2
Definition
Probable Type III restriction-modification system enzyme Mod (EC:2.1.1.72)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
hiz  Haemophilus influenzae R2866 (nontypeable)
Brite
Enzymes [BR:hiz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     R2866_1776 (mod2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1809236..1812136)
Genome map
AA seq 966 aa AA seqDB search
MAGFTYEKNLPHQERAIESVLAVFDLVHLNTKVQNDENPLIEFAGSLKTDNLQKIQQANN
VADIALSHSNVLDISMETGTGKTYTYTKTMFELNRELGVFKFIVVVPTLSIKAGTKNFLQ
STSLAEHFRKDFAGQYGETEIELYVVESQKNKAKKAFMPSEIVRFVQAEDKQKIHVLLIN
AGMINSDTMAGKDKGNDGSRLIKDKFSVPFEALASTNPFVIIDEPHKFPTSKKTWENIQK
FNAQFILRYGATFNNQFENLLYRLSAIDAFNDDLVKGIRAFTEQIDGDNGERIKLIDLDG
KEATFILDKQAFKLSKGENLNRIHQAISDLFVSEMNKSVLVLSNGIELKKGDTINPYSYS
DTVRDKMMRQAIRKHFVLEKELLTRNGGRIKPLTLFFIDDIAGYRDEKNQLSGSLKTVFE
QMVKAELEHRLQTENDEFLRQYWQTALNDIAKTHGGYFSQDNSDKDDKIEQEVNEILHDK
ETLLSLANPRRFVFSKWTLREGWDNPNVFQICKLRSSGSETSKLQEVGRGLRLPVNEYMA
RVKDHAFFLNYFVDNSETDFVKKLTDEVNSAVVKPIVFTALTDELIKKIQTAYPDVSKKQ
IRNQLADLTDDDDVFLENGFAETKKLFPKAFESSGSLKDGKIKGSGEKVEKVKMRIAKYD
ELKALWETINQKALLQYKIKDEDEFLSLFIRYLKENADKFTATGIRTVQNKIRVDNGLLS
ATETRSLNDEVFEPINTLNYREFLLKLSQTALIQMQTLHKAFFALRDVLEISKFLNERTI
HTIKAGFDRWLLFNSFNAFEVGFSRVGGSVHPTKFTDNQGNALTEVNASDLGTQFDSGSP
LAEFLFESVFFDSELEHANITKNQVKEVIVFTKIPKNSIKIPVAGGGTYSPDFAYIIKTS
SGDRLNLIVESKNVPDNQSLRSEEQQKIKHAEKLFNLVASDMKLVFKTQFEKDEIVNIIK
NAQKQR
NT seq 2901 nt NT seq  +upstreamnt  +downstreamnt
atggctggctttacttacgaaaaaaatttgccccatcaagaacgagcgattgaatccgtt
ttggcagtgtttgaccttgtgcatttaaatacaaaagtacaaaatgatgaaaaccctttg
attgaatttgcaggcagtctgaaaacggataatttgcaaaaaatccaacaagccaataac
gtggccgatatagcgttatcccatagcaatgtgcttgatatttcaatggaaacggggaca
ggcaaaacttatacctacaccaaaactatgtttgagctcaatcgtgagctgggcgtgttt
aaatttatagtggttgtgcccactctttccattaaagcaggaacgaaaaactttttgcaa
agcacgtcgcttgcagaacattttcgcaaggattttgcagggcaatatggcgaaacagaa
attgaattgtatgtagtagaaagccaaaaaaacaaagcaaaaaaagcctttatgccctct
gaaattgtgcgttttgtgcaagcagaagataagcagaaaatccacgtcttattgattaac
gcaggtatgattaattccgacacaatggcgggaaaagataagggcaatgacggcagccgt
ttgattaaagataagttttctgtgccctttgaggccttggcttcaactaatccctttgtg
attattgatgaaccgcataagtttcctacaagcaaaaaaacgtgggaaaacatacagaaa
tttaatgcccaatttattttgcgttatggtgccacctttaacaatcaatttgaaaatttg
ctttatcgattaagtgcgattgatgcatttaatgatgatttagtaaaaggcattcgtgca
tttactgaacaaattgacggagataatggcgagcggattaaactgattgatttagacggc
aaagaagcgacgtttattttagataaacaagcatttaagttaagtaaaggcgaaaattta
aaccgtattcatcaagccattagcgatttatttgtctctgaaatgaataaaagcgtgctg
gtgttgagcaatggtattgagttaaaaaaaggcgataccatcaatccgtattcatacagc
gatactgtgcgggataaaatgatgcgacaagcaattagaaaacattttgtcttggaaaaa
gaattgcttacgagaaatggcggacggattaaaccactgactttgtttttcattgatgac
attgctggctatcgtgatgagaaaaatcaactttcaggcagcctaaaaaccgtttttgag
caaatggtaaaagcggaattagaacatcgtttgcaaacagaaaatgatgaatttctacgc
caatattggcaaacggcattaaacgatattgccaaaactcacggcggttatttttcgcag
gataacagcgataaagatgacaaaattgagcaagaagtaaatgaaattttgcacgataaa
gaaaccttgttatcgcttgctaatccacgccgttttgtattttctaagtggacgttgcgg
gagggatgggataatcctaatgtgtttcaaatttgcaaattgcgttctagtggctctgaa
acaagcaaattgcaggaagtcggtcgtggcttgcgtttacctgtaaatgaatatatggca
agagtaaaagatcacgcctttttcttgaattattttgtggataatagcgaaacagatttc
gttaaaaaattaactgatgaagtgaatagtgcggtggtaaaaccgattgtttttacggct
ttaactgatgaattaattaagaaaattcagacggcttatcctgatgtcagtaagaaacag
attcgcaatcaattagcagatttaaccgatgacgatgatgtctttttagaaaacggcttt
gctgaaacgaaaaaattattcccgaaagcctttgaaagttcaggcagcctgaaagatgga
aaaatcaaaggttcaggcgaaaaagttgaaaaagtcaaaatgcgtattgctaaatatgat
gaattaaaagccttatgggaaacgattaaccaaaaagccttgttgcaatacaaaataaaa
gatgaagatgaatttttgagtttgtttatccgttatctgaaagaaaatgcggataaattt
acggcaactggcatacgcaccgtacaaaataaaattcgtgtggataatggtttattgtct
gccactgaaacaagaagcctgaacgatgaagtttttgaaccgattaatacgctgaattat
cgtgagtttttattgaaattatctcaaacagctttgattcaaatgcagactttgcacaag
gcattttttgcgcttcgtgatgtgttggagatttcaaaattcctgaatgaacgcacgatt
cacacgataaaagcagggtttgaccgctggttattgttcaattcctttaatgcgtttgaa
gtaggatttagccgtgtgggtggcagtgttcacccaacaaaatttacggataatcaaggt
aatgcgttgacagaagtgaatgcttcggatttaggtacacagtttgattcgggtagccca
ttggctgaatttttgtttgaaagtgtgttttttgatagtgaattggaacacgcaaacatt
acgaaaaatcaagtaaaagaagtgattgtgtttaccaaaattcccaaaaattccatcaaa
atcccagtggcaggcggcggcacatactcgcccgattttgcttatattataaaaacaagc
tcgggcgatcggcttaatttgattgtagaaagtaagaatgtaccagacaatcaatcttta
cgttcggaagagcagcaaaaaattaaacacgcagaaaaattgtttaatctcgttgcatcg
gatatgaaacttgttttcaaaacccaattcgagaaagatgaaattgttaatattataaaa
aatgcacagaaacaacgatga

DBGET integrated database retrieval system