KEGG   Haemophilus influenzae R2866 (nontypeable): R2866_1834Help
Entry
R2866_1834        CDS       T01981                                 

Gene name
pldB
Definition
Putative lysophospholipase L2 (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
hiz  Haemophilus influenzae R2866 (nontypeable)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:hiz00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1875367..1876308
Genome map
AA seq 313 aa AA seqDB search
MIREPYFHQFALAELLPFFEQFPTQYLSGKRNIKLAYRHLIQPESAVRKLMILVNGRAEN
MLKWSELAYDFYHQGYDVLLFDHRGQGYSQRIIPQKGHLDEFRFYVDDMAKIIEKVTALF
SYSTQHLLAHSMGALIATYYLANCDHYINKAVLSSPFYGILLKHPIRDELIITLMNILGQ
GERYVFGKGAYQQAHLEYNELTFCKTRMKWMNRVNRKNPAINLGGPTFRWVHLCLNAIKR
LPKVIPKIEIPILILQAEKEKIVDNKNLEKLTALFPNAQCKVVLNAKHEVLFEKDNVRRN
VLKSVNHFLNVQS
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgatcagagaaccttattttcatcaatttgctcttgcagaattattgcctttttttgag
caatttcctacccaatatctttctggtaaacgaaatataaaattagcttatcgtcatttg
attcaacctgaaagtgcggtcagaaaattgatgattttagtaaatggtcgagcagaaaat
atgctgaaatggtcagagctcgcttatgatttttatcatcaaggttatgatgtattgcta
tttgatcatcgcggtcaaggctattcacagcgtattattcctcaaaaagggcatttagac
gaatttcgtttctatgtcgatgatatggcaaaaatcatcgaaaaagtgaccgcacttttc
agctattcaacacagcatttgcttgctcattcaatgggcgcattgattgcaacctattat
ttggcaaattgtgatcattacattaataaagcggtactttcttcgcctttttacggtatt
cttttaaaacatcccattagagatgaactgattattaccctaatgaatattttaggacaa
ggcgagcgttatgtttttggcaaaggtgcttatcaacaagcccacttggaatacaatgaa
ttaactttctgtaaaaccagaatgaaatggatgaatcgtgtaaatcgtaaaaatccagca
attaatcttggcgggccaacattccgttgggtacacttgtgtttgaacgcaattaaacgc
ttgccgaaagttattcctaagattgaaattccaatcctaattttacaagccgaaaaagaa
aaaatagtagataacaaaaatcttgaaaaattaaccgcactttttccgaatgctcaatgt
aaagttgtattgaacgctaaacatgaggtgttatttgaaaaagataatgttcgaagaaat
gtacttaaaagtgttaatcattttctaaatgtgcaaagttga

DBGET integrated database retrieval system