KEGG   Halalkalicoccus jeotgali: HacjB3_00005Help
Entry
HacjB3_00005      CDS       T01271                                 

Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hje  Halalkalicoccus jeotgali
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hje00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HacjB3_00005
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HacjB3_00005
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HacjB3_00005
Enzymes [BR:hje01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HacjB3_00005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
108..1259
Genome map
AA seq 383 aa AA seqDB search
MSSGEFEGYGGRHVPEALEGPLSELAAAYDEVGKSEGFQEEFRGYLEEFAGRPTPLYHAR
NLSERYGAEIYLKREDLLHGGAHKINNTLGQALLAKKAGKERLIAETGAGQHGVATAMVG
ALFGLETEIYMGEKDVARQEMNVVRMGLMGAEVNEVTRGGAGLADAVDVALEDFAGNVED
THYLVGSVVGPDPFPRMVRDFQSVIGEEAREQFRERVGELPDATVACVGGGSNAIGLFHA
FRDDPVDFYGAEGGGEGSDSARHAAPLAQGRDDTLHGMHTRVLDEGVEVHSVSAGLDYPG
VGPEHAMFRAIGRAEYTGVTDEEALAAFRELSETEGIIPALESSHAIARAIQLAEAGEHE
TILVNLSGRGDKDMETAAERFSL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgggagaattcgagggatacggcggacgtcacgttccggaagcgctcgaagga
ccgctctcggaactcgcagcggcctacgacgaggtcgggaaaagcgaggggttccaagag
gagttccggggctatctggaggagttcgcgggccgaccgacgccgctgtatcacgcgcgc
aacctgagcgagcgctacggcgcggagatctacctcaaacgcgaggacctcctccacggc
ggtgcccacaagatcaacaacacgctcggacaggcgctgttggcgaagaaagcgggcaaa
gagcggttgatcgccgagacgggcgcgggccagcacggggtcgcgaccgcgatggtcggc
gcgctgttcggcctcgagacggagatctacatgggcgagaaggacgtcgcccgccaggag
atgaacgtcgtccgaatgggcctgatgggtgcggaggtaaacgaggtcacccgcggcggg
gcggggctggcggacgccgtcgacgttgccctggaggacttcgccgggaacgtcgaagac
acccactacctcgtgggcagcgtcgtcggccccgacccgtttccgcggatggttcgggat
ttccagtcggtgatcggcgaggaggcccgcgagcagttccgcgagcgggtcggcgaactg
ccggatgccacggtcgcctgcgtcgggggcggctcgaacgccatcgggctgtttcacgcc
ttccgtgacgatccggtcgacttctacggcgcggagggtggcggtgagggcagcgattcc
gcccgccacgccgccccgctcgcacagggacgggacgacaccctccacgggatgcacacc
cgagtcctcgacgagggtgtcgaggtccactcggtgtcggcgggtctcgattaccccggc
gtcggccccgaacacgcgatgttccgggcgatcggtcgggcggagtacaccggtgtcacc
gacgaggaggcgcttgcggccttcagggaactcagcgagacagaggggatcatccccgcg
ctcgaatcgagccacgcgatcgcccgggcgatccagttggccgaggccggcgagcacgaa
acgatcctcgtgaacctctcggggcgaggggacaaggacatggagaccgcggccgagcgg
ttctcgctctag

DBGET integrated database retrieval system