KEGG   Halalkalicoccus jeotgali: HacjB3_00005Help
Entry
HacjB3_00005      CDS       T01271                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hje  Halalkalicoccus jeotgali
Pathway
hje00260  Glycine, serine and threonine metabolism
hje00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hje01100  Metabolic pathways
hje01110  Biosynthesis of secondary metabolites
hje01130  Biosynthesis of antibiotics
hje01230  Biosynthesis of amino acids
Module
hje_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hje00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HacjB3_00005
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HacjB3_00005
Enzymes [BR:hje01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HacjB3_00005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADJ13394
UniProt: D8J3Q3
Position
108..1259
Genome map
AA seq 383 aa AA seqDB search
MSSGEFEGYGGRHVPEALEGPLSELAAAYDEVGKSEGFQEEFRGYLEEFAGRPTPLYHAR
NLSERYGAEIYLKREDLLHGGAHKINNTLGQALLAKKAGKERLIAETGAGQHGVATAMVG
ALFGLETEIYMGEKDVARQEMNVVRMGLMGAEVNEVTRGGAGLADAVDVALEDFAGNVED
THYLVGSVVGPDPFPRMVRDFQSVIGEEAREQFRERVGELPDATVACVGGGSNAIGLFHA
FRDDPVDFYGAEGGGEGSDSARHAAPLAQGRDDTLHGMHTRVLDEGVEVHSVSAGLDYPG
VGPEHAMFRAIGRAEYTGVTDEEALAAFRELSETEGIIPALESSHAIARAIQLAEAGEHE
TILVNLSGRGDKDMETAAERFSL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgggagaattcgagggatacggcggacgtcacgttccggaagcgctcgaagga
ccgctctcggaactcgcagcggcctacgacgaggtcgggaaaagcgaggggttccaagag
gagttccggggctatctggaggagttcgcgggccgaccgacgccgctgtatcacgcgcgc
aacctgagcgagcgctacggcgcggagatctacctcaaacgcgaggacctcctccacggc
ggtgcccacaagatcaacaacacgctcggacaggcgctgttggcgaagaaagcgggcaaa
gagcggttgatcgccgagacgggcgcgggccagcacggggtcgcgaccgcgatggtcggc
gcgctgttcggcctcgagacggagatctacatgggcgagaaggacgtcgcccgccaggag
atgaacgtcgtccgaatgggcctgatgggtgcggaggtaaacgaggtcacccgcggcggg
gcggggctggcggacgccgtcgacgttgccctggaggacttcgccgggaacgtcgaagac
acccactacctcgtgggcagcgtcgtcggccccgacccgtttccgcggatggttcgggat
ttccagtcggtgatcggcgaggaggcccgcgagcagttccgcgagcgggtcggcgaactg
ccggatgccacggtcgcctgcgtcgggggcggctcgaacgccatcgggctgtttcacgcc
ttccgtgacgatccggtcgacttctacggcgcggagggtggcggtgagggcagcgattcc
gcccgccacgccgccccgctcgcacagggacgggacgacaccctccacgggatgcacacc
cgagtcctcgacgagggtgtcgaggtccactcggtgtcggcgggtctcgattaccccggc
gtcggccccgaacacgcgatgttccgggcgatcggtcgggcggagtacaccggtgtcacc
gacgaggaggcgcttgcggccttcagggaactcagcgagacagaggggatcatccccgcg
ctcgaatcgagccacgcgatcgcccgggcgatccagttggccgaggccggcgagcacgaa
acgatcctcgtgaacctctcggggcgaggggacaaggacatggagaccgcggccgagcgg
ttctcgctctag

DBGET integrated database retrieval system