KEGG   Halalkalicoccus jeotgali: HacjB3_00130Help
Entry
HacjB3_00130      CDS       T01271                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
hje  Halalkalicoccus jeotgali
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hje00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HacjB3_00130
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HacjB3_00130
   00020 Citrate cycle (TCA cycle)
    HacjB3_00130
   00620 Pyruvate metabolism
    HacjB3_00130
Enzymes [BR:hje01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     HacjB3_00130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
29564..31078
Genome map
AA seq 504 aa AA seqDB search
MVREFKLPDVGEGVAEGEIVQWLVSEGDEVSEDQPVAEVETDKAVVEVPSPVDGSVKEIL
AEEGEVVPVGNVIITFAVEGEEEETAESEAPTHSQERVSEEPAEIGEEDETETPAGRTFA
PPNVRRLARELGVDISSVSGSGPSGRVTEGDVREAAEGGNEETKGPKQLDEGLPSATRKA
GEEGGSATGADTADLESADRDRTLAAPATRKLAEEEGVDLNRVPTDEERDGEAFVTPEAV
RQYATAQREAQAADAAAVAESGTEASTGGEPTGSEERLPYRGIRRTIGRQMANSKFTAPH
VSHHDTADVKRLVEARADLKDRAEDRGVKLTYMPFIMKAIVAALKEFPELNASLDEEAEE
IVVKHYYNIGIAVATDAGLMVPVVRNVDEKGLLQLASEVNELAQKARERSISREEMQGGT
FTITNFGAIGGEYATPIINHPEVGILGLGKLTERPVAEDGEVRAAHTLPLSLSIDHRVID
GAEAAMFANRVIEYLENPTLLLLE
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggtccgcgagttcaaactgcccgacgtcggcgagggcgtcgcggagggcgagatcgtc
cagtggttggtctcggaaggcgacgaagtcagcgaggaccagccggtcgcggaggtcgag
acggacaaagcggtcgtcgaggtcccctcgccggtcgacggttcggtaaaggagatcctc
gccgaggagggcgaggtcgtccccgttggaaacgtcatcatcacgttcgcggtggaaggc
gaggaagaagaaacggccgagagcgaagcaccgacgcactcccaagaacgggtcagcgag
gaaccggcggagatcggtgaggaggacgaaaccgaaacgcccgcagggcgaacgttcgcc
ccgccgaacgtccgacgactggcccgcgaactcggcgtcgatatttcgagcgtgtcgggc
tcgggcccaagtggccgggtcaccgagggggacgtgcgcgaggccgcggaagggggcaat
gaggaaacaaagggaccgaaacagctcgacgagggactgccgtcggcgacccggaaggcg
ggcgaggaggggggttcggctaccggggccgacaccgcagacctcgaatcggcggatcga
gaccggacgctggccgcacccgcgacacggaagctcgccgaggaggaaggcgtcgacctg
aaccgagtcccgaccgacgaggagcgcgacggcgaggcgttcgtcacgcccgaggcggtc
cgacagtacgcgaccgcccagcgcgaggcacaggctgccgacgccgcggctgtcgcggaa
agcgggaccgaagccagcacaggaggcgaaccgacgggaagcgaggagcgccttccctac
cgggggatccgccggacgatcggccgtcagatggcgaactcgaagttcaccgccccgcac
gtcagccatcacgacaccgccgatgtgaagaggctcgtcgaggcgcgcgccgatctgaaa
gatcgcgccgaggaccggggtgtgaaactgacctacatgcccttcatcatgaaggcgatc
gtcgccgccctgaaggagttccccgaactgaacgcctcactcgacgaggaggcagaagag
atcgtcgtcaagcactactacaacatcggcatcgccgtcgccacggacgcgggcctgatg
gttcccgtcgtaaggaacgtcgacgagaaggggctcctccagctggcgtcggaagtgaac
gaactcgcccagaaggcccgcgagcgctcgatcagtcgggaggagatgcagggcggcacg
ttcacgatcacgaacttcggggcgatcggcggggagtacgccaccccgatcatcaaccat
cccgaagtcggcattttgggcctcggaaagctgaccgagcgcccggtcgccgaggacggt
gaggtgcgggcggcccacacgctgccgctgtcgctgtcgatcgaccaccgcgtgatcgac
ggggcggaggcggccatgttcgcgaaccgcgtgatagagtacctagagaacccaacgctg
ctgctactagaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system