KEGG   Halalkalicoccus jeotgali: HacjB3_00470Help
Entry
HacjB3_00470      CDS       T01271                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
hje  Halalkalicoccus jeotgali
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hje00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HacjB3_00470
Enzymes [BR:hje01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     HacjB3_00470
Exosome [BR:hje04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HacjB3_00470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
100156..101154
Genome map
AA seq 332 aa AA seqDB search
MDITKRPRRLRSDGVRPLISETALSPADLIAPVFVDATADERVPIESMPGHERVPVDGIV
ERVQEVRETGVEAVMLFGIPAEKDEQGTQAWVDDGVVQRALRRISEETDAYAIADLCFCE
YTTHGHCGVVEEDAKEDPRQTVDNDATLELIERTALSQARAGADMIAPSGMMDGMVGTIR
DALDREGFTEVPIMSYAVKYESAFYGPFRDAADGAPAFGDRRHYQMDPANRQEAVREARL
DIEQGADVLMVKPALPYLDIVRDVRETTDLPVAAYNVSGEYAMLHAASEKGWLDLEEVAR
ESLLSIKRAGADLILTYFAESIASECSAGRRT
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggacatcacgaagcgcccgcgccgccttcggagcgacggggtccggccactgatcagc
gagaccgcgctctccccggcggacctgatcgcgccggttttcgtcgacgccaccgccgac
gagcgcgtccccatcgagtcgatgcccggccacgagcgcgtgcccgtcgatgggatcgtc
gagcgggtacaggaggtacgagagacaggcgtcgaggccgtcatgctctttggcatcccc
gcggagaaagacgagcagggcactcaagcgtgggtcgacgacggcgtcgtccagcgcgca
ctccggcggatctccgaggagaccgacgcctacgcgatcgccgacctctgtttctgtgaa
tacaccacgcatgggcactgcggagtggtggaagaggatgcgaaggaggacccgcgccag
acggttgacaacgacgcgactctcgagctgatcgagcgcacggcactctcacaggcgcgg
gcgggcgcagacatgatcgctccgagtggcatgatggacggcatggtcggcaccatccgg
gacgcgctagatcgcgagggctttaccgaggtcccgatcatgagctacgccgtcaaatac
gagtcggcgttctacggccccttccgggacgccgccgacggcgcacccgccttcggcgac
cggcgacactaccagatggaccccgcgaacaggcaagaggcggttcgcgaagcccgcctc
gacatcgagcagggtgcggacgtcctcatggtcaagcccgcgttgccctacctcgacatc
gtccgggacgtccgcgagacgaccgacctgccggtcgccgcctacaacgtctccggggag
tacgcgatgttgcacgccgcaagcgagaagggctggctcgatctggaggaggtcgcacgg
gagtcgttgctctcgatcaaacgggcgggtgcggacctgatcctgacgtatttcgccgaa
agcatcgcgagcgagtgttccgcgggccgccggacgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system