KEGG   Halalkalicoccus jeotgali: HacjB3_00540Help
Entry
HacjB3_00540      CDS       T01271                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hje  Halalkalicoccus jeotgali
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hje00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HacjB3_00540 (hemD)
Enzymes [BR:hje01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     HacjB3_00540 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
115699..116442
Genome map
AA seq 247 aa AA seqDB search
MTQETRIAVFRPDDERLSEAVDLLESLGADAVPDPMLAVEPTGARPREDADFTVLTSKTG
VELAREAGWHPSGTVCAIGDRTGRALREAGYEVDLIPEEFSSSGLVRALEGEVAGACVEV
ARSDHGSPVLTDGLNEAGAYVHETVLYELVRPPESGVSVERAAAGELEGALFTSSLTVEH
FLAAADERGLREEAVDGLSTSIVGAIGAPTRETAARKGIAVDVVPDAASFEELACAVVER
AAPSYRD
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgacccaagagacgcggatcgcggtctttcggccggacgatgagcgtctctccgaggcg
gtcgacctgctcgaatcgctcggggccgatgcggtcccggacccgatgctcgcggtcgag
ccgacgggcgcacgcccgcgagaggacgccgatttcacggtcctgacgagcaagaccggc
gtcgaactcgctcgggaggcgggctggcacccttcgggaacggtctgtgcgatcggcgac
agaaccggtagagcgctccgggaggcgggctacgaggtcgatctgatccccgaggagttc
tcctcttcggggctcgttcgcgccctcgaaggtgaagtggctggcgcgtgcgtcgaggtc
gcccgctcggatcacggcagtcccgtcctcaccgacgggctgaacgaggcgggcgcgtac
gtccacgagacggtgctgtacgagctggtccgcccgccggaatcgggcgtctcggtcgag
cgggccgccgccggcgaactcgagggtgcgctgtttacctcctcgttgaccgtcgagcac
ttcctcgcggccgccgacgagcgcgggctacgcgaggaggcggtcgacgggctttcaact
tcgatcgtcggcgcgatcggcgcgccgacccgcgagacggccgcgcgcaaggggattgcg
gtcgacgtcgttcccgacgcggcgagcttcgaggagctggcctgtgccgtcgtcgagcgg
gccgccccgagctatcgggactga

DBGET integrated database retrieval system