KEGG   Halalkalicoccus jeotgali: HacjB3_00780Help
Entry
HacjB3_00780      CDS       T01271                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hje  Halalkalicoccus jeotgali
Pathway
hje00010  Glycolysis / Gluconeogenesis
hje00620  Pyruvate metabolism
hje00640  Propanoate metabolism
hje00680  Methane metabolism
hje00720  Carbon fixation pathways in prokaryotes
hje01100  Metabolic pathways
hje01110  Biosynthesis of secondary metabolites
hje01120  Microbial metabolism in diverse environments
hje01130  Biosynthesis of antibiotics
hje01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hje00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HacjB3_00780
   00620 Pyruvate metabolism
    HacjB3_00780
   00640 Propanoate metabolism
    HacjB3_00780
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    HacjB3_00780
   00680 Methane metabolism
    HacjB3_00780
Enzymes [BR:hje01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     HacjB3_00780
Lipid biosynthesis proteins [BR:hje01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   HacjB3_00780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADJ13549
UniProt: D8J4I7
Position
158443..160074
Genome map
AA seq 543 aa AA seqDB search
MSTHNMADYDDLCESFEWADIHAEADWNAPEELNIAHEVCDRHPSDRTALEYAGSEGERE
TLTFGDLTERSNRFANVLSDLVDRGDRVFSYMPRVPEHYVALVGTLKAGAVFGGINERFG
PEGIAYRLDDCDATAIVTTAANRGTVGEALADAPSVEHVIIVGDGREGDDRDFHTECEAA
SPEFETVRTSGDDDALLYYTSGTTGRAKGVLHKHRWIAGVAATQRFAVDLQGEDLYWSTG
DLGWLTGPINALGAWFWGTSQFTYEGEFEPEAWAGLLDEHPITVLFSVPTAYRMLRERES
VLDGVDLHLRHALSIGEPLSAGVVDWGEDRLGVTIHDTYGQTETGNMIVNNYPTMEVRPG
SMGKPLPGIEATVVDPETGEPLPAGETGEIAQRGDYPCFFAEYWNQPEKTEACFENDWYL
SGDLGYLDSEGYFWFEGRADDVIISSGYRIGPFEVESSLGEHEAVAEAAVVPKADPERGN
IVKAYVVPSAGAEPSDGLVSDIQEHVKRELAAHEYPREIEFRDELPKTVTGKIRRTELRE
ETG
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgtccacgcacaacatggccgactacgacgacctctgtgagtccttcgagtgggccgat
atccacgccgaggccgactggaacgcccccgaggagttgaacatcgctcacgaggtctgt
gaccgtcatccctctgatcgaaccgcactggagtacgccggaagcgagggcgaacgcgag
acgctcaccttcggcgacctgaccgagcgctcgaaccgctttgcgaacgtcctgtccgat
ctcgtcgaccgaggcgaccgcgtcttttcgtatatgccccgcgtacccgaacactacgtc
gcgctcgtaggcacgctgaaggccggcgcggtcttcggcgggatcaacgagcgcttcggt
cccgaggggatcgcctaccgactcgacgactgcgacgcgacggcgatcgtcacgaccgcc
gcgaaccgcgggacggtcggggaggccctcgcggatgccccgtcggtcgagcacgtgatc
atcgtgggcgacggtcgtgagggcgacgaccgcgacttccacaccgaatgcgaggccgca
agccccgagttcgagaccgtccgtacatctggggacgacgacgccctgctgtactacacc
agcggcacgacgggccgggcgaagggcgtgcttcacaaacaccgctggatcgcaggcgtc
gcggccacccagcgcttcgcggtcgaccttcagggcgaggacctctactggtcgaccggg
gatctgggctggctcaccggcccgatcaacgccctcggggcgtggttctgggggacgagc
cagttcacctacgagggcgagttcgagcccgaggcgtgggcagggctgctcgacgaacac
cccatcaccgtcctgtttagcgtccccacggcctatcggatgctccgcgagcgcgagtcg
gtcctcgacggggtcgacctgcacctgcgccacgccctctcgatcggcgaacctctctcc
gctggtgtcgtcgactggggcgaagaccggctgggtgtgacgatccacgacacctacggc
cagaccgagacgggcaacatgatcgtcaataactacccgacgatggaggtgcgcccgggg
agcatgggcaaacccctcccggggatcgaggcgaccgtcgtcgatcccgagaccggcgag
cccctcccggcgggcgaaaccggcgagatcgcccagcgcggcgattacccctgctttttc
gccgaatactggaaccagcccgagaagaccgaggcgtgtttcgaaaacgactggtatctc
tcgggcgatctgggctatctcgactctgaggggtatttctggttcgagggccgggcagac
gacgtgataatctcctctgggtatcggatcggcccctttgaggtcgagagctcgctgggc
gaacacgaggcggtcgccgaagccgccgtcgtccccaaggctgaccccgagcggggcaac
atcgtcaaggcctacgtcgtccccagcgcgggggcagagccctccgacgggctcgtctcc
gacatccaagagcacgtcaaacgcgaactcgcggcccacgagtacccccgcgagatcgag
tttcgcgacgaattgccgaagacggtaacgggaaagatccgccggacggaactccgcgag
gagacgggttag

DBGET integrated database retrieval system