KEGG   Halalkalicoccus jeotgali: HacjB3_00950Help
Entry
HacjB3_00950      CDS       T01271                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hje  Halalkalicoccus jeotgali
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hje00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HacjB3_00950
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HacjB3_00950
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HacjB3_00950
Enzymes [BR:hje01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HacjB3_00950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(196713..197969)
Genome map
AA seq 418 aa AA seqDB search
MSPNLTIGTEAVPDVADDGVWLECIETGEQYAPFEGVRYRSDAGALLEVRYAEHPTFDTF
SGTGVWRYADALPVEREVTIEEGATPLYEVPRLEDEVGVESLRIKHEGMNPTGSFKDRGM
TVGVGVAQRLGVDRLACASTGNTSAALAAYGGRAGMETVVLLPAGKVAAGKIAQASLHGA
RILEVDGNFDTCLDIVQELANQGEAYLLNSLNPFRLEGQKTIGFEILERHREEYGEFPDR
IVLPVGNAGNTAALYKAFRELVASGALDEEEVPKLTGVQAEGAAPMVEAVEEGREEVERW
EEVETRATAIRIGNPVNAPKALPGIRATGGTAVAVSDEEITNAQRALAGEGVGVEPASAA
SVAGLRKLREEGVVGSEERVVCLTTGHLLKDPDAAAEAGVEPESVPGETAGVLEHLRS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgagtccgaacctcacgatcgggaccgaagccgtccccgacgtcgccgacgacggtgtc
tggctcgaatgcatcgaaaccggcgagcagtacgcccccttcgagggagtcaggtatcgc
agcgacgcgggcgcgctgctcgaagtgcgctacgccgaacacccgacgttcgacaccttt
tcgggaaccggcgtctggcgctacgccgacgcgcttccagtggagcgggaggtcaccatc
gaggagggcgcgaccccgctgtacgaagtgccccggctggaagacgaggtcggcgtcgaa
tcactccggatcaaacacgagggaatgaacccgacggggagcttcaaggaccggggcatg
accgtcggcgtcggcgtcgcccaacggctcggcgtcgaccggctggcctgtgcttccact
ggaaacacgagcgccgcgctcgccgcgtacggcgggcgtgcgggcatggaaaccgtggtc
ttgctcccggcgggcaaggtcgccgcgggcaagatcgcccaggcgagcctgcacggcgca
cgtatcctcgaagtcgatggtaacttcgacacctgtctcgacatcgtccaggagttggcg
aaccaaggcgaggcctacctgctcaactcgctgaaccccttcaggctcgaaggccagaag
acgatcggcttcgagatcctcgaacgccaccgcgaggagtacggcgagttccccgatcgg
atcgtcctccccgtcggcaacgcgggcaacaccgcggcgctgtataaggccttcagggag
ctcgtcgcgagcggcgcgctcgacgaagaggaggtccccaagctcaccggcgtgcaggcc
gagggcgcggcaccgatggtcgaggccgtcgaggaagggagagaagaagtcgagcgctgg
gaggaagtcgagacgcgcgcaaccgcgattcggatcggcaacccggtgaacgcgcccaaa
gcgctgccgggcatccgggcgacaggcgggacggccgtcgcggtctcggacgaggagatc
acgaacgcccagcgggccttggcgggcgagggcgtcggcgtcgagcccgcctcggcggcg
agcgtcgcgggcctgcggaagcttcgggaggagggcgtcgtggggagcgaggagcgcgtg
gtctgtctgacgaccggtcatctactaaaagaccccgacgcggcggccgaagccggcgtg
gaacccgagtcggtgccgggtgagacggcgggcgtgctggagcatctcagaagttag

DBGET integrated database retrieval system