KEGG   Halalkalicoccus jeotgali: HacjB3_03830Help
Entry
HacjB3_03830      CDS       T01271                                 

Definition
class III aminotransferase
Orthology
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
hje  Halalkalicoccus jeotgali
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hje00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    HacjB3_03830
   00650 Butanoate metabolism
    HacjB3_03830
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HacjB3_03830
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HacjB3_03830
Enzymes [BR:hje01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     HacjB3_03830
Amino acid related enzymes [BR:hje01007]
 Aminotransferase (transaminase)
  Class III
   HacjB3_03830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(761441..762784)
Genome map
AA seq 447 aa AA seqDB search
MNRDNAEPSVRRLPGERTREWIEHHHRYSAPSEHAHEFAWDVAGESEGPFCTDLDGNVFL
DFTCHIGAAPLGYNNPKITDRMAEFDLVDPLKIAGQDFYAGSAGGPEEPEIPGAAQLMER
LVEVSSQYDMDTVFLSNSGAEAIENAMKISYANTPERKYGITFLGAFHGRTLGTLSMTRA
GDVYTRAYPETAGTRTVPFCEDRACEASTCSCGFFAGGRSQLERMLDPERGYMDPREVAF
LILEPIQGVGGYRFPSEAFMEEVQRVCETHDIHLIVDEIQSGIGRTGEMWASDHYAIEPD
VITSAKALRSGATISRSEIFPEEKNRLGSTWGGGDLVAAAQGVFTLDAIDEYDLLENAVE
RGRQVKELLGDADLEGVTDVRGKGLMLAVEFDSKERRTAVVKAGLQRGLLTLGCGHSTIR
LLPPLDVTEREIDLGISLFRDAIEATR
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtgataacgcggagccgagcgtgcggcggcttcccggggagcggacccgcgag
tggatcgagcaccaccaccgctactccgcgcccagcgagcacgcccacgagttcgcctgg
gacgtcgccggggagtcggagggaccgttctgtaccgacctcgacggcaacgtctttctg
gatttcacctgccatatcggggccgcaccgcttggctacaacaacccgaagatcaccgat
cgcatggccgagttcgatctggtcgacccgctgaagatcgccggtcaggacttctacgcc
ggctcggcgggtgggcccgaagaacccgagattccgggggcggcccaattgatggaacgg
ctcgtcgaggtgtcctcgcagtacgacatggacaccgttttcctctcgaactcgggcgcg
gaggcgatcgagaacgcgatgaagatctcctacgcgaacactcccgagcgaaagtacggc
atcacctttctgggggcgtttcacggccggacgctgggaacgctctcgatgacgcgcgcc
ggcgacgtctatacgcgtgcctatcccgaaaccgccggcactcgaaccgttccgttctgc
gaggatcgggcctgtgaggcatcgacctgttcgtgtggctttttcgccggcggacgctcg
cagctcgaacgaatgctcgaccccgagcggggctatatggacccgcgggaggtcgccttc
ctgatcctcgaaccgatccagggcgtcggcgggtatcgcttcccgagcgaggcgtttatg
gaggaggtccagcgggtctgtgagacccacgacatccacctgatcgtcgacgagatccag
tcggggatcgggcgcacgggggagatgtgggcgtcggaccactacgccatcgaacccgac
gtgatcaccagcgcgaaggcgctccggtcgggcgcgacgatctcgcgctccgagatattc
cccgaggaaaaaaaccgactcggctcgacatggggcggtggcgatctcgtcgcggcggcc
caaggcgtgttcaccctcgacgcgatcgacgagtacgacctgttagagaacgccgtcgag
cggggccggcaagtgaaagaactgctcggcgacgccgacctcgaaggggtgacggacgtc
cgcgggaaggggttgatgctcgccgtcgagttcgactcgaaagaacgccgtaccgcggtc
gtaaaggcagggttacagcgggggctgctcacgctgggttgtggccacagcacgatccga
ctgctcccgccgctcgacgtcaccgaacgcgagatcgacctcggtatctcgctgtttcgc
gacgcgatcgaggcgactcgataa

DBGET integrated database retrieval system